KEGG   Yersinia pestis A1122: A1122_15400Help
Entry
A1122_15400       CDS       T01831                                 

Definition
(GenBank) LysR family transcriptional regulator
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AEL73703
Position
complement(3342157..3343062)
Genome map
AA seq 301 aa AA seqDB search
MHDLNDLYYYAEVVEHGGFSAAARVLGLPKSKLSRRLALLEERLGVRLIQRSTRRFAVTD
VGRTYYEHCKAMIEEARAAQESIDLTRAEPRGVVRITCPVALLQATVSTMLADFMASCPL
VTIHLEATNRQVDPVAEAIDIAIRVRPPPLQNSDLVLRVLGNRCQCLVASPELIGRQGEV
NTPVDLTGWPSLGLGQPQQTFIWNLEGPEKAHAAVYHQPRLVTADMNTLRSAALAGVGVV
QLPLMMVTEQLAEGTLVRLLPDWSVRHEIIHAVYPSRRGLLPSVRSVLDYLVQRFSQLDE
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatctcaatgatctctattactacgcagaagttgtagaacatggcgggttcagc
gccgctgcacgggtgttgggcttgcctaagtccaagctaagccgccgattggctctgctt
gaggaacgtctgggggtgcggctcattcaacgctcaacccggcgctttgctgtcactgat
gttggccgtacctattacgagcattgtaaagcgatgatcgaagaggcaagagcggcgcag
gagtctattgatttaacacgtgcggaaccacgcggtgtggtgcgaatcacctgcccggtg
gcgctgttgcaggcgacggtcagtaccatgctggcggattttatggccagttgtcctctg
gtgacgattcatctggaagcgactaaccggcaggttgatcccgttgctgaggccattgat
attgcgattcgcgtgcggccaccgccattacaaaatagcgatttagtgctgcgggttctg
ggtaatcgctgccagtgtttggtcgctagccctgagttgatagggcgacagggtgaagta
aatactccagttgatctaaccggttggccaagccttgggttagggcaacctcagcaaacg
tttatttggaacttagaagggccggagaaggctcatgcagcggtgtatcatcagccgcgg
ttggtgacagcagatatgaataccttacgcagtgcggcattggccggtgtaggggtagta
caattgccactgatgatggtgacggaacaactggccgaaggcacattagttcgcctattg
cctgattggtcagtccgccatgagattattcatgctgtctatccttcaaggcgcgggttg
ctaccttcggtacgcagcgtattggattatcttgttcagcgcttcagccaattggatgaa
cggtga

DBGET integrated database retrieval system