KEGG   Yersinia pestis A1122: A1122_15430Help
Entry
A1122_15430       CDS       T01831                                 

Gene name
nhaB
Definition
(GenBank) sodium/proton antiporter
  KO
K03314  Na+:H+ antiporter, NhaB family
Organism
ypt  Yersinia pestis A1122
Brite
Transporters [BR:ypt02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   A1122_15430 (nhaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NhaB CitMHS DUF5313
Motif
Other DBs
NCBI-ProteinID: AEL73709
Position
3350097..3351671
Genome map
AA seq 524 aa AA seqDB search
MDITNRQAVLKNFLGNSPDWYKLAIMGFLIINPLVFFFVSPFVAGWMLVIEFIFTLAMAL
KCYPLQPGGLLAIQAVAIGMTSPHQVAEEIANNLEVLLLLVFMVAGIYFMKQLLLFVFTK
LLLNIRSKTILSLAFCLASAFLSAFLDALTVIAVVISVSVGFYTIYHNVTSNHSDKDITD
DSGIDNQDSHETLEQFRAFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKSAGWNFADFF
IRMLPVTLPVFIFGLLVCLLVEKFKLFGYGAQLPERVRQVLTEYDQQANAKRTKQEKMKL
IVQAIIGVWLVLALALHLAEVGLVGLSVIILATSFCGITNEHSLGKAFQEALPFTALLTV
FFAVVAVIIEQSLFTPIIQFVLQASPSAQLSLFYLFNGLLSSVSDNVFVGTVYINEARSA
FEHGIVSLQQFELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLSYGRMVYMAL
PYTLVMTIVGLLGVEFLLVPMTEWLTQAGWISLPHITNGVAIPH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggacattaccaacagacaagctgtactcaagaattttcttggtaactctccggattgg
tacaaactagcaattatggggttcttgatcattaaccctctagtcttcttctttgtcagc
ccctttgtcgcgggctggatgctggttatcgagtttatctttaccttagccatggcgctg
aaatgttacccgctgcaaccggggggtttgctcgctattcaagccgttgccatcggcatg
accagcccgcatcaagttgcagaagagatcgccaataacctggaagtcctcttgctttta
gtatttatggtggccggcatctactttatgaaacagctgctgctgtttgtatttacgaaa
ttgctgttgaatattcggtcaaaaactatcctttccctggccttttgtctggcgtcagcc
ttcctatcagcatttttggatgccttaaccgtaatcgcggtagttatcagcgtatccgtt
ggtttttatactatttatcataacgttacttcaaatcacagtgacaaagatattactgat
gacagcggaatcgataatcaggacagccatgaaacattagagcaattccgggcattttta
cgcagtctgatgatgcatgctggcgtgggtaccgctctggggggcgtcatgacaatggtt
ggtgagcctcagaatttgattattgccaaaagcgcgggttggaattttgctgacttcttt
attcgcatgttacccgtcaccttacccgtctttattttcgggttattggtctgcttgctg
gtcgaaaaatttaaactgtttggttatggtgcccagttgccagaacgtgtgcgtcaggtt
ctgaccgaatacgatcagcaagccaatgcgaaacggaccaagcaagagaagatgaagtta
atagtacaagccattattggtgtctggttggtattggcactggcactccatttagctgaa
gtcggtttggtcgggctatccgttattattctcgccacctcattttgtggtatcacaaat
gagcattcattgggcaaagcctttcaggaagccttgccgtttaccgcgctgctaaccgta
ttttttgccgtggtcgcggttattattgaacaaagcctctttacccccattattcagttt
gttttacaagcctcgccttccgctcagctatcgctgttttatctgtttaatggcttgctc
tcatcggtgtcagacaatgtttttgtcggtaccgtgtatatcaatgaggcccgttctgcg
tttgagcatggtattgtctcgttacaacaatttgaattgttggcggtcgccatcaataca
gggaccaacctcccctccgtggcgacaccaaacggccaggccgctttcttgttcctgctg
acttcggcattggcaccactaattcgcctttcctatgggcgaatggtatatatggctttg
ccttatactctagtgatgacgattgttggcctgctgggtgtcgagtttttattggtaccg
atgacagagtggctgactcaggctggatggatcagtttgccacacatcacaaacggggtt
gccatcccacactga

DBGET integrated database retrieval system