KEGG   Yersinia pestis A1122: A1122_15460Help
Entry
A1122_15460       CDS       T01831                                 

Definition
(GenBank) transposase for the IS285 insertion element
  KO
K07493  
putative transposase
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3357739..3358947
Genome map
AA seq 402 aa AA seqDB search
MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEKNTPKSGSNT
RNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREI
VATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIVYMDCIVVKVRQNGSVIN
KAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRGLQDILIACVDGLKGFPDA
INSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVYQAPTEEAALMALDKFAEAW
DDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDS
VRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLSDHL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaaagaaacttaaagcacttgcggctgaactggctaaaggtcttaaaaccgaa
gccgaccttaatgcattttctcgtatgctaacaaagcttaccgtcgaaacagcgttaaat
gcagagcttaccgaacacctcgggcacgagaaaaatacccctaaatcaggctcgaatacc
cgcaacggctattcgtccaaaacactgctatgcgacgacggcgaaatcgagctgaatacg
ccacgcgaccgcgaaaacacctttgaaccgcagctgataaagaaaaatcagacgcgtatc
acacagatggacagccagattttgtccctgtacgccaaaggcatgaccacccgcgaaatc
gtcgccaccttcaaagagatgtatgacgccgatgtgtctcccacgctgatatctaaagtc
accgatgccgtaaaagagcaggttgctgaatggcaaaaccgccaactggatgctctgtat
cccattgtttatatggactgcattgtcgtaaaagtccgccagaacggtagcgtgataaac
aaagcagtgttcctagcgctgggcatcaacactgaaggtcagaaagagctgctgggcatg
tggctggcagaaaatgaaggtgcgaagttctggctaagtgtgctgacagagctaaaaaat
cgcggtcttcaggacattctgattgcctgcgtggatggcctgaaggggttcccggatgcg
ataaacagtgtttatccgcagactcacatccagctgtgcatcatccatatggtacgcaac
agcctgaaatatgtgtcatggaaggactataaagccgtcaccagcggtttgaaaatggtg
tatcaggctccgacagaagaggcggcgctgatggcgctggataagtttgcggaggcctgg
gacgacaaatacccgcaaattagcaaaagttggcgtacgcactgggaaaatctcaataca
ttcttcggctatccgcccgatatccgcaaggctatctacaccacgaatgccatcgaatcg
gtgaacagcgtgatccgtgcagccattaaaaagcgcaaagtgttcccgacagacgactca
gtgcggaaggttgtttatttggcgatcaaggatgcatcaaaaaaatggagtatgccgatc
cagaactggcggttagcgatgagccgttttattatcgagttcggtgaccgcctgagcgat
cacctttaa

DBGET integrated database retrieval system