KEGG   Yersinia pestis A1122: A1122_15480Help
Entry
A1122_15480       CDS       T01831                                 

Definition
(GenBank) putative phage host specificity protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1983 Phage-tail_3 fn3 DHFR_2
Motif
Other DBs
NCBI-ProteinID: AEL73719
Position
complement(3361530..3364733)
Genome map
AA seq 1067 aa AA seqDB search
MARKPIKGRKGGGSNATTPVESPDSIQSTARAKILIALGEGEFAGGLDGTNIYLDGTPIK
NSDGTSNFTGVTWEYRPGTQAQDYIQGMPNVENEITVNTELKSDTPWVRSITNTQLSATR
VRLGWPSLQRQADNGDVGGYRIEYAVDVATDGGAYQTLLDTAIDGKTTTLYERSHRINLP
KATAGWQVRTRRKTANANSGRIADKMNVEAISEVIDAKLRYPNTALLYIEFDATQFQNIP
IISCEPKGRIIRVPTTYDPVTRTYSGVWDGSFKWAHTNNPAWVFYNIVLADRFGLGHRIE
VSQVDKWELYRIGQYCDQLIPDGRGGSGTEPRFTCDVYIQSQAEAFTVLRDLAAIFRGMT
YWGNNQLCTLADMPRDVDYIFTRASVIDGRFTYGGGSEKKRYTTAMVSWSDPANNCQDAI
EAVSDNDLVRRYGVNQLDMTAIGCIRQTEANRRGRWALLTNSKDRTVNFNVGLDGAIPLP
GHIIGVADDMLSGRKMGGRISSVSGRNITLDRVADVKAGDRLLVNLPNGVAQGRTVQVVN
GKVITVTTAYSEVPAAESGWSVDADDLAIQQYRVTGISDNDDNTYSISSVQHDPDKYERI
DTGARIDERPISVIPPGVQPPPTNVVIDSFSALSQGLAITTLRVTWEPAASAIAYEAEWR
RDNGNWISAPRTSAQGFQVEGIYAGQYQARVRAINPSEISSIWANAQETTLNGKEGNPPM
PVGFTATGILFGITLNWGYPEGAEDALKTEIEYSLSADGTDAMLLSDVPHPQRNYTMQGL
RAGQVFWFRARIVDKSGNQSPWIDWVRGMSSTDTSAILEAIGDDFINNTVAGQQLINDDF
MNAEGILETAKANNASIWQQWAQHGENKAGVIHLTTTVADAERAFAEFETLVTATFEDQT
AAIDQKMTAVVDANGASATYSLRAGLNYNGQFVSAGMVIGAEFINGVAKSSIGFTADQFI
LLSGPTGNLFSPFAVVNGQVFMNDAFIAKASIGRGKITDTLDSDNYVQGISGLKLDFKNG
NAEFNNVNLRGNITMDNTINGIRTIVDYRGQRTYHANGQPAIICGYF
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaaaccaattaaaggccgcaaaggtgggggcagcaatgccacaacgccagtt
gagtcaccggacagtattcaatcgacggcaagagctaaaatactcattgctttgggtgag
ggggagttcgccggaggtttggatggaaccaatatctatctggacggcacacctataaag
aactctgacggtactagtaatttcactggggttacttgggagtatcgtcccggcacgcag
gctcaggactacattcaaggaatgccaaatgtcgagaatgagataacggttaacacagag
cttaaatcagatacgccatgggtgcgctccatcacaaatacccaactctcggctacacgt
gttcgtcttggatggccctcattacagcgtcaggcggacaatggtgatgttggcggttat
cgcattgagtacgccgtcgatgtggcaacggatggtggcgcatatcaaacactgcttgat
acagccattgatgggaaaacaacaactttatatgaacgctcgcacagaataaacctaccc
aaggccacagctggttggcaggttcgtacaaggcgaaaaacagccaatgccaactctggc
cgcattgccgacaagatgaatgtcgaagctatttctgaagtcatcgatgccaagttacgt
tacccaaataccgcgcttctctatatagaattcgacgcaactcaatttcagaatatccct
attatctcatgtgagcctaaaggccggattatccgcgtacctactacatatgatccagta
acgcgtacctactctggtgtgtgggatggttcatttaaatgggctcataccaacaaccca
gcctgggtattctacaacattgtattagcagatcgctttggccttggtcatcggattgag
gtcagccaggtagataagtgggagctgtaccgaattggtcaatactgcgatcagcttatt
cctgatggtcggggcggtagtggtactgagcctcgttttacctgcgatgtgtatattcag
tctcaggccgaggcatttactgtattgcgtgatttggccgccatttttcggggcatgacc
tattggggaaataatcagctttgcaccctggcagatatgccacgagatgtggactatata
tttacccgtgccagtgtgattgacggacgattcacttacggtggtggttccgagaaaaag
cgctatacaaccgcaatggtgagctggagtgaccccgcaaataactgtcaggatgcaatc
gaggcagtgtcagataacgacttggttcgtcgctacggtgtcaatcagcttgatatgacg
gctatcggctgtatccggcaaactgaggcgaataggcgtggacgttgggcgctactgaca
aacagtaaagaccggactgttaattttaatgtagggttagacggggccattccgttgccc
ggtcatatcattggtgttgcggatgatatgctctctggtcggaagatgggcggtcgcatt
agctcagtatcgggccggaatatcactcttgaccgtgttgctgatgtgaaagcaggtgac
cggctacttgttaacttaccaaacggtgtagctcagggcagaacggtgcaagtggtcaac
gggaaagtaatcactgtcacaacggcttacagtgaagtgccagcagcggaaagcggttgg
tctgttgatgcggatgatttagctatccagcaatatcgggttactggtatttctgacaat
gacgacaatacatacagtatctcatctgttcagcatgatccggacaaatatgagcgaatt
gatacgggcgctcggattgatgaaagacccatcagcgtaatcccgcccggcgtccagcca
cctccgacaaatgttgttattgatagcttctcagcactttcacaagggctcgcaataacc
accctacgtgttacgtgggaaccagcagccagcgcgatagcatacgaggctgaatggcga
cgtgataacggaaactggatatcagcaccgcgcacatctgctcagggatttcaggttgaa
ggtatttatgctggacaatatcaggctcgcgttcgtgctattaacccctcagaaatatcc
agtatttgggctaatgctcaggaaaccacattaaacggtaaagagggaaatcctccaatg
ccagttggatttacagctacaggcattctctttggcatcactctcaattggggataccct
gaaggagccgaagatgcgttaaaaacagagattgaatatagcctgtctgctgacggcacc
gatgccatgctgttgagtgatgtgccgcatccgcaacggaactacactatgcaggggttg
agagcagggcaggtgttctggttccgtgctcggatagttgataaatccggtaatcagtcg
ccatggattgattgggttcgtggcatgtccagcacagacacaagcgctattctcgaagcg
attggcgacgactttatcaataacacagttgcgggtcagcaactgattaatgatgacttc
atgaatgcagagggcattctcgaaacagcgaaggccaataacgccagcatctggcagcaa
tgggctcaacacggagagaataaagccggtgttatccacttaacgaccactgttgccgat
gctgaaagagcatttgctgagtttgaaacccttgttacagcaacatttgaagaccagaca
gcagcgatagaccaaaaaatgacagcagttgttgatgccaacggggctagtgctacttat
agtttaagggccggactgaattataacggccagtttgtcagcgcaggcatggtaattggt
gcagagtttattaatggtgtagctaaatcctcaattggttttactgccgatcaatttata
ttgctctccggtccaactggtaatttattttcgccttttgcagtggtaaatggtcaagtg
tttatgaatgatgcatttattgcaaaggcatcaattgggcgaggaaaaataacagatacc
cttgactcagataattacgtgcaaggaatatccggtctaaaactggattttaaaaatggt
aatgctgaatttaacaatgtaaatctcagggggaatataactatggataacacgattaat
ggtattcgcaccatagtagattatcgtgggcagaggacatatcacgcaaatggtcagcca
gcgataatatgcgggtacttctaa

DBGET integrated database retrieval system