KEGG   Yersinia pestis A1122: A1122_15490Help
Entry
A1122_15490       CDS       T01831                                 

Definition
(GenBank) putative phage tail assembly protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3365305..3365925)
Genome map
AA seq 206 aa AA seqDB search
MTLFAQEVMTPIKLSGSLAKMFGRDHQRLVGSSGEVIKALCVTIPGFEQYLMTAKQRGLT
FAVFKNKRNVGKDELELASGGQEIRIVPVIIGSKRGGLFQTILGVALIGMATFMSGGLAV
AFGAGGVWGGAMAMMGASMALGGVIQMLSPQQSGLAMRQSPDNKPSYAFGGPVNSTAQGN
PVGVLYGKRRIGGAVISAGIYAEDQM
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgactttatttgcgcaagaagtaatgacaccaatcaaactaagcggttcattagctaag
atgttcggtcgcgaccatcaacgattagttggtagctctggcgaagttattaaggcttta
tgcgtaactattcctggctttgagcaatacctgatgacggctaagcagcgtggactcacg
tttgctgtattcaaaaataagagaaatgtcggcaaggatgagttggagcttgcaagtggt
ggacaagaaattcgtattgttcctgtaattatagggagcaaacgcggtgggctgttccag
accatactcggcgtagctttaatcggtatggcaacatttatgagtggaggcttggcggtg
gcgtttggcgcgggtggagtatggggtggtgcaatggcaatgatgggcgcatccatggcc
cttggcggcgttatccaaatgctatcaccgcagcagagtgggttagccatgaggcaatca
ccagacaacaagccaagctatgcattcggcggcccggttaactctacggctcagggtaac
ccggtgggcgtactctacggcaagcgtcgaattggcggggcggttatctcggcgggtatt
tatgctgaagatcaaatgtaa

DBGET integrated database retrieval system