KEGG   Yersinia pestis A1122: A1122_15555Help
Entry
A1122_15555       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_TAC_4
Motif
Other DBs
NCBI-ProteinID: AEL73734
Position
complement(3376269..3376580)
Genome map
AA seq 103 aa AA seqDB search
MAVKFTLVPSPTFKVDVTIPRAGLDDGILTFTFRHMPVNEVINMEKVEGQSGLDFAEKFI
EGWALPEVFSRENLEVLANNYPKAIEAIVGAFYRELLGNREKN
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaaatttacgctggtaccgtcgccaacatttaaagttgacgtcactatccct
cgcgctggtctggatgacggtattttaacattcacgtttcgacacatgccggtgaatgaa
gtcatcaatatggagaaagtggaggggcagtccgggctggattttgcagaaaaattcatt
gagggatgggcgctccctgaggtgtttagcagggaaaatctggaggtgcttgcgaataac
tacccgaaagctatcgaagcaattgtcggtgctttctaccgtgaattactcggtaatcgc
gaaaaaaactaa

DBGET integrated database retrieval system