KEGG   Yersinia pestis A1122: A1122_15650Help
Entry
A1122_15650       CDS       T01831                                 

Definition
(GenBank) putative prophage endopeptidase
  KO
K14744  prophage endopeptidase [EC:3.4.-.-]
Organism
ypt  Yersinia pestis A1122
Brite
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     A1122_15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysis DUF1043 OTCace PH_11
Motif
Other DBs
NCBI-ProteinID: AEL73753
Position
complement(3389971..3390429)
Genome map
AA seq 152 aa AA seqDB search
MPGKLTTALIAVIAALLVGVTYYQNEAAKLQRDVVEIASVANQQKKDLQLIEAQRQAVAA
IDIKTTKELADVKSENERLRTDIASGTKRLQLNATCSKPAPKTTGPASVPDDASARLTNA
AERDYLSLRERIGIATSQISGLQDYITNVCLK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaaagttaactactgccctcattgctgtaattgccgccctgcttgttggtgtg
acttattatcagaacgaggcggcaaaacttcagcgtgatgtagtagaaatagcatcagtg
gctaatcagcagaagaaagaccttcagctaatcgaagcccagcgccaagccgtagccgct
atcgatatcaaaaccaccaaggaattagcagatgtcaaatctgaaaacgagcgcctgcgc
actgatatcgcttctggcactaagcggttgcaactcaacgccacatgttcaaaaccagcg
cccaaaaccaccggccccgccagcgtccctgatgatgccagcgccagacttactaacgcc
gctgaacgggattatctcagtctccgcgagcgtatcggaattgccacaagccaaataagc
ggcttacaggactacatcactaacgtgtgcctgaagtaa

DBGET integrated database retrieval system