KEGG   Yersinia pestis A1122: A1122_15695Help
Entry
A1122_15695       CDS       T01831                                 

Definition
(GenBank) phage nin-region protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3394208..3394654)
Genome map
AA seq 148 aa AA seqDB search
MDKKVFVLCGDQYKRNAIQFISQLPVNPDKPLLITIQERTRTLDQNARLWATLGDIAKQV
VWHGQKLSSEDWKHIFTASLKGQRSAPGLEGGFVVLGQSTSRMTVGELRDLIELINAFGA
THGVKFSDESRLAIEWANRFGDKGKVAA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaggtcttcgtgttatgcggtgatcaatacaagcgaaatgccatccagttt
ataagtcaactacctgttaatcctgataaaccactcctgatcacaatccaagagcgaacc
cgcacattagaccagaatgcgcgtctatgggccacgcttggcgatatcgctaaacaggtt
gtatggcacggacagaaacttagcagtgaggactggaagcacatattcactgcatcactg
aaagggcagaggtcagcgccagggcttgaaggtggctttgttgtactggggcaatcaaca
agccgcatgaccgttggcgagctgcgcgacctgatagagctgatcaatgctttcggcgct
acgcatggcgttaagttcagcgatgaatcacggcttgcaattgagtgggccaaccggttc
ggtgacaagggaaaggtggcagcatga

DBGET integrated database retrieval system