KEGG   Yersinia pestis A1122: A1122_15775Help
Entry
A1122_15775       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEL73778
Position
3408257..3408388
Genome map
AA seq 43 aa AA seqDB search
MARLEPTWMYLRRLYDLPVLSVAGTLSITSGAGLRAFLWPKIS
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggctcgagcctacatggatgtatttacggcgtctttacgatctgcctgttctc
tccgtcgcgggcactttgtcaataacctcaggcgctggactccgcgcctttttgtggccc
aaaattagctag

DBGET integrated database retrieval system