KEGG   Yersinia pestis A1122: A1122_15795Help
Entry
A1122_15795       CDS       T01831                                 

Definition
(GenBank) putative DEAD box family helicase
  KO
K03722  
ATP-dependent DNA helicase DinG [EC:3.6.4.12]
Organism
ypt  Yersinia pestis A1122
Brite
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     A1122_15795
DNA repair and recombination proteins [BR:ypt03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    A1122_15795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3409896..3411800)
Genome map
AA seq 634 aa AA seqDB search
MIDDFATDGALAQAIKGFNPRESQRQMAAAISEAIDAKQQLVVEAGTGTGKTFAYLAPAL
RADCKVIISTGSKALQDQLYSRDLPMMVTALKYKGKLALLKGRSNYLCLERLEQQSLAGG
DLASETLVDLVRLRGWSAETVDGDISTCGQVAEDSFVWPLVTSTNDNCLGSDCPLYKDCF
VVKARRRAMDADVVVVNHHLFLADMVVKESGFAELIPTADVMIFDEAHQIPDIASQYFGQ
QLTSRQLMDLAKDIIIAYRTEVRDSAQLQKSADRLTQSTQDFRLVLGDPGYRGNLRDVME
QPTVQRALLLLDDALELCYDVMKLSLGRSAMLDAALERATVYRNRLKRLKDVRTPGYSYW
YECNSRHFVLALTPLSVSDRFRELIEEKPGTWIFTSATLSVNDQLSHFTLRLGLTHAKTL
LLPSPFDYANQALLCVPRNLPSANEPGAARKLAVLLKPLIDANQGRCFFLCTSHQMMRGL
AEEFRASMTLPVLVQGETSKGQLLAQFVAAGNALLVATSSFWEGVDVRGDALSCVIIDKL
PFTSPDDPLLKARIEDCRLRGGDPFNDVQLPDAVITLKQGVGRLIRDIDDRGVLVICDNR
LVMRPYGAMFLNSLPPAPRTRDLAKAIAFLKQRD
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
gtgatagacgattttgcaacagacggcgcattagcgcaggctattaaaggttttaatccc
cgtgagtctcagcgccagatggctgcggcaatcagtgaagccattgatgccaaacagcaa
ttggtggtagaagcgggtaccggtaccggtaagacgtttgcctatttagctccggcgttg
cgggctgattgcaaagtgatcatctccaccggctccaaggcattgcaggatcagctctat
tcccgtgatcttcctatgatggtgaccgcgctaaaatacaaaggcaaattggctttattg
aaaggccgttcaaactatctttgcctggagcgccttgaacagcagtcattggcaggcggg
gatttagccagtgagacattggtcgatttggttcggttacgtggttggtcagcagagacg
gttgatggtgatatcagcacctgtggtcaggttgcggaagacagttttgtctggccactg
gttaccagtaccaatgataattgtctgggtagcgattgcccgctgtataaagattgtttt
gtggtgaaagcccgtcgtcgggcgatggatgctgatgtggtggtggtaaaccaccatctt
tttctggcggacatggtggtgaaagagagtgggtttgccgaacttattccaaccgctgat
gtgatgatttttgatgaggcgcatcaaatccccgatattgccagccagtattttggtcaa
cagctcaccagccggcaactgatggatttagcaaaagatattattattgcctatcgcacc
gaggtgcgtgactccgcccaattacaaaaaagtgcggaccgtctgacgcaaagtacacag
gattttcgtttagtgctgggcgatcccggttaccgtggcaacttgcgcgatgtgatggaa
caacctacggttcaacgagcgttattgttacttgatgatgctctggaactttgctacgac
gtaatgaaactctcgcttggtcgctcggcaatgctggatgccgccttagaacgcgctacc
gtttatcgtaaccgcctcaagcgattaaaagatgtcagaacccccggttacagctattgg
tatgagtgtaattcacgccatttcgtattggcgctgaccccgttgtctgtttctgatcgc
ttccgggagttgattgaggaaaaaccaggcacctggattttcacctcagcgacactctcg
gtgaacgatcaattgtcgcatttcacgttgcgcttagggctaactcacgccaaaaccttg
ttattacccagtccgtttgattatgccaatcaggcgttgctctgtgtgccgcgcaattta
ccctccgcaaatgagccgggggcggctcgcaaattagcggtgctattaaagccgctgatt
gatgcaaaccaagggcgctgtttcttcctgtgtacttctcatcagatgatgcgtggatta
gctgaggagtttcgcgctagcatgacattgcctgttttggttcaaggggagaccagtaaa
gggcagctcttggcgcaatttgtcgctgcgggtaatgcgctacttgtggcaaccagcagt
ttttgggagggggttgatgtgcgtggcgatgccttgtcatgcgtgattatcgataagctg
ccatttacctcgccggacgatccgttgttaaaagcccgcattgaggattgccgcttacgc
ggtggtgacccgtttaatgatgtgcaattaccggatgcggttatcaccctcaagcaaggg
gtggggcgtttgattcgtgatattgatgatcgcggtgtgttggtgatttgcgataaccgt
ttggttatgcgtccttatggcgcgatgttcttaaatagcttacccccggcaccccggaca
cgggatctggcgaaagccatcgcctttctcaagcagcgcgattaa

DBGET integrated database retrieval system