KEGG   Yersinia pestis A1122: A1122_15805Help
Entry
A1122_15805       CDS       T01831                                 

Definition
(GenBank) multidrug efflux system protein MdtI
  KO
K11742  spermidine export protein MdtI
Organism
ypt  Yersinia pestis A1122
Module
ypt_M00711  Multidrug resistance, efflux pump MdtIJ
Brite
Transporters [BR:ypt02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   A1122_15805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA TMEM234 UPF0060 TMEM100
Motif
Other DBs
NCBI-ProteinID: AEL73782
Position
complement(3412407..3412736)
Genome map
AA seq 109 aa AA seqDB search
MQQLEFYPIAFLILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE
LSVAYALWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcttgagttttaccctatagctttcttgatcttggccgttatgctggaaatc
gtcgctaatatcttgctgaaaatgtcagatggctttcgccgaaaatggttggggatattg
tccctgttgtcagtattaggcgcattcagtgcattggcgcaagcagtgaaggggattgag
ctgtcggtagcttatgccttgtggggcggttttggtattgcggccactgttgcggcgggc
tggattctgtttaatcaacggttgaactacaaaggttggattggtttgatcttactgctg
gcgggcatggtgatgattaagttgtcatag

DBGET integrated database retrieval system