KEGG   Yersinia pestis A1122: A1122_15815Help
Entry
A1122_15815       CDS       T01831                                 

Definition
(GenBank) keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
  KO
K01625  
2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
ypt  Yersinia pestis A1122
Pathway
Pentose phosphate pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A1122_15815
   00630 Glyoxylate and dicarboxylate metabolism
    A1122_15815
Enzymes [BR:ypt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     A1122_15815
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     A1122_15815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3413881..3414522)
Genome map
AA seq 213 aa AA seqDB search
MKSWKTSAEQIMTAGPVVPVIVINKLEQAVPLAKALVAGGVRVLEVTLRTPCAVEAIRAI
AKEVPEAIIGAGTVLNPQQLAEVVEAGAQFAISPGLTDELLKAACEGSIPLIPGISTVSE
LMLGMSYGLREFKFFPAEANGGVKALQAIGGPFSQVRFCPTGGITPNNYRDYLALKSVLC
IGGSWLVPADALESGDYARITELAKQAVEGAAA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctggaaaacgagcgcagaacagattatgaccgcaggtcctgttgtcccggtg
atcgtgatcaataagctcgagcaagcagtaccgttggcaaaagctctggtggcaggcggt
gttcgcgtactggaagtgacgttgcgtaccccttgtgctgtggaggccatccgcgcgatt
gccaaagaagttcctgaggcaattattggtgctggaaccgtgcttaacccacaacaactg
gctgaagtggttgaagctggcgctcagtttgccattagccctggtttgactgatgaactg
cttaaagcggcctgcgaagggtctatcccattgattccaggtatcagcaccgtttcagaa
ctgatgctggggatgagctatggtttgcgtgagtttaaattcttcccggctgaagctaac
ggtggtgtcaaagcgttgcaagccattggcggcccattctcgcaagtccgtttctgccca
actggcggtatcacaccaaataactaccgtgattatttagcactgaagagtgtattgtgc
attggtggctcatggttggttcctgctgacgcgttggagagtggtgactacgcgcgcatt
actgaattagcgaagcaagcggttgaaggtgcggcagcataa

DBGET integrated database retrieval system