KEGG   Yersinia pestis A1122: A1122_15835Help
Entry
A1122_15835       CDS       T01831                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00010  Glycolysis / Gluconeogenesis
ypt00230  Purine metabolism
ypt00620  Pyruvate metabolism
ypt01100  Metabolic pathways
ypt01110  Biosynthesis of secondary metabolites
ypt01120  Microbial metabolism in diverse environments
ypt01130  Biosynthesis of antibiotics
ypt01200  Carbon metabolism
ypt01230  Biosynthesis of amino acids
Module
ypt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypt_M00002  Glycolysis, core module involving three-carbon compounds
ypt_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ypt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1122_15835
   00620 Pyruvate metabolism
    A1122_15835
  Nucleotide metabolism
   00230 Purine metabolism
    A1122_15835
Enzymes [BR:ypt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     A1122_15835
Membrane trafficking [BR:ypt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    A1122_15835
Exosome [BR:ypt04147]
 Exosomal proteins
  Proteins found in most exosomes
   A1122_15835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C Peptidase_M20
Motif
Other DBs
NCBI-ProteinID: AEL73788
Position
3417800..3419242
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKIIAAGANVVRLNFSHGSAEDHELRANKVREIAAR
LGRHVAILGDLQGPKIRVSTFKEGKVFLNINDKFLLDANMAKGEGDKNKVGIDYKGLPAD
VVPGDILLLDDGRVQLKVVEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKA
DIVTAAKIGVDFLAVSFPRTGEDLHYARRLARDAGCNAQIVAKVERAEAVATDEAMDDII
LASDVVMVARGDLGVEIGDPELVGIQKKLIRRARQLNRAVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPAETVAAMARVCLGAEKIPSINVSKHRLDVQFDN
VEEAIAMSTMYAANHLKGITAIIAMTESGRTALMMSRISSGLPIFAMSRHDHTLNLTAIY
RGVTPVYCDPHTDGVLAATEAVKRLQDKGFLVSGDLVIVTQGDVMGTIGTTNTSRIIRVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagacggctcagaaggaccaagattgttactacactggggccggctactgaccgc
gacaataatctggaaaagattattgctgcaggtgcgaacgtagtccgcctgaatttttcc
catggtagcgctgaagatcatgaattacgggccaataaagtccgtgaaatcgctgccaga
ctggggcgtcatgtagctattcttggtgatttgcaaggtcctaaaatccgggtatcgacg
tttaaagaaggtaaagttttccttaatataaacgataaattcctgctggatgccaatatg
gcaaaaggcgaaggtgataaaaacaaagtgggtatcgattacaaaggcctgccagctgat
gtggttcccggtgatattttattgcttgatgatggccgcgtgcagttaaaagtggttgaa
gttcagggcatgaaagtcttcaccgaagtgaccgtcggtggcccgctctctaacaataaa
ggcatcaacaagttaggtggcgggttatcagccgaagccctaaccgaaaaagataaagcc
gatattgttaccgctgcaaaaattggtgtggacttcctggcggtctctttcccacgtact
ggtgaagatttgcattatgcacgccgcctggcccgtgatgctggctgcaatgcacagatc
gtcgcaaaggttgagcgcgctgaagcggtcgccactgatgaggcgatggatgatatcatt
ctggcctctgacgtcgtcatggtcgctcgtggtgatttgggtgttgaaattggcgaccca
gaacttgttggtatccaaaagaaactgatccgccgtgcccgccagctaaaccgtgccgtg
atcacggcgactcagatgatggagtcaatgatcaccaacccgatgccaacccgagcagag
gtgatggatgttgccaacgcagtgctggatggtaccgatgcggtcatgttgtcagcagaa
acagcagcaggccagtacccggcagaaaccgtagcggcaatggcgcgtgtctgtctaggc
gcggaaaaaatcccaagcatcaatgtgtcaaaacaccgtctagatgtgcaattcgataac
gtcgaagaagctatcgcgatgtcgaccatgtatgcggcaaaccacctcaaaggtatcacc
gcgattatcgccatgactgaatcaggccgcacggctttgatgatgtcgcgtatcagttcc
ggtttacctattttcgccatgtcgcgccatgatcatactttaaacctaaccgccatctat
cgtggcgtgacgccggtctattgtgatccccatactgacggtgttcttgccgccacagaa
gcagtaaaacgcttgcaagataaagggttcttggtgtcaggtgatttggttatcgttact
cagggcgatgtgatgggcaccattggtacgaccaataccagtcgtatcatccgcgtcgaa
taa

DBGET integrated database retrieval system