KEGG   Yersinia pestis A1122: A1122_15835Help
Entry
A1122_15835       CDS       T01831                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
ypt  Yersinia pestis A1122
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A1122_15835
   00620 Pyruvate metabolism
    A1122_15835
  Nucleotide metabolism
   00230 Purine metabolism
    A1122_15835
Enzymes [BR:ypt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     A1122_15835
Membrane trafficking [BR:ypt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    A1122_15835
Exosome [BR:ypt04147]
 Exosomal proteins
  Proteins found in most exosomes
   A1122_15835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3417800..3419242
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKIIAAGANVVRLNFSHGSAEDHELRANKVREIAAR
LGRHVAILGDLQGPKIRVSTFKEGKVFLNINDKFLLDANMAKGEGDKNKVGIDYKGLPAD
VVPGDILLLDDGRVQLKVVEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKA
DIVTAAKIGVDFLAVSFPRTGEDLHYARRLARDAGCNAQIVAKVERAEAVATDEAMDDII
LASDVVMVARGDLGVEIGDPELVGIQKKLIRRARQLNRAVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPAETVAAMARVCLGAEKIPSINVSKHRLDVQFDN
VEEAIAMSTMYAANHLKGITAIIAMTESGRTALMMSRISSGLPIFAMSRHDHTLNLTAIY
RGVTPVYCDPHTDGVLAATEAVKRLQDKGFLVSGDLVIVTQGDVMGTIGTTNTSRIIRVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagacggctcagaaggaccaagattgttactacactggggccggctactgaccgc
gacaataatctggaaaagattattgctgcaggtgcgaacgtagtccgcctgaatttttcc
catggtagcgctgaagatcatgaattacgggccaataaagtccgtgaaatcgctgccaga
ctggggcgtcatgtagctattcttggtgatttgcaaggtcctaaaatccgggtatcgacg
tttaaagaaggtaaagttttccttaatataaacgataaattcctgctggatgccaatatg
gcaaaaggcgaaggtgataaaaacaaagtgggtatcgattacaaaggcctgccagctgat
gtggttcccggtgatattttattgcttgatgatggccgcgtgcagttaaaagtggttgaa
gttcagggcatgaaagtcttcaccgaagtgaccgtcggtggcccgctctctaacaataaa
ggcatcaacaagttaggtggcgggttatcagccgaagccctaaccgaaaaagataaagcc
gatattgttaccgctgcaaaaattggtgtggacttcctggcggtctctttcccacgtact
ggtgaagatttgcattatgcacgccgcctggcccgtgatgctggctgcaatgcacagatc
gtcgcaaaggttgagcgcgctgaagcggtcgccactgatgaggcgatggatgatatcatt
ctggcctctgacgtcgtcatggtcgctcgtggtgatttgggtgttgaaattggcgaccca
gaacttgttggtatccaaaagaaactgatccgccgtgcccgccagctaaaccgtgccgtg
atcacggcgactcagatgatggagtcaatgatcaccaacccgatgccaacccgagcagag
gtgatggatgttgccaacgcagtgctggatggtaccgatgcggtcatgttgtcagcagaa
acagcagcaggccagtacccggcagaaaccgtagcggcaatggcgcgtgtctgtctaggc
gcggaaaaaatcccaagcatcaatgtgtcaaaacaccgtctagatgtgcaattcgataac
gtcgaagaagctatcgcgatgtcgaccatgtatgcggcaaaccacctcaaaggtatcacc
gcgattatcgccatgactgaatcaggccgcacggctttgatgatgtcgcgtatcagttcc
ggtttacctattttcgccatgtcgcgccatgatcatactttaaacctaaccgccatctat
cgtggcgtgacgccggtctattgtgatccccatactgacggtgttcttgccgccacagaa
gcagtaaaacgcttgcaagataaagggttcttggtgtcaggtgatttggttatcgttact
cagggcgatgtgatgggcaccattggtacgaccaataccagtcgtatcatccgcgtcgaa
taa

DBGET integrated database retrieval system