KEGG   Yersinia pestis A1122: A1122_15880Help
Entry
A1122_15880       CDS       T01831                                 

Gene name
ruvC
Definition
(GenBank) Holliday junction resolvase
  KO
K01159  
crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
ypt  Yersinia pestis A1122
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1122_15880 (ruvC)
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     A1122_15880 (ruvC)
DNA repair and recombination proteins [BR:ypt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A1122_15880 (ruvC)
    RecFOR pathway proteins
     A1122_15880 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3426843..3427364)
Genome map
AA seq 173 aa AA seqDB search
MAIVLGIDPGSRVTGYGVIRQQGRQLTYLGSGCIRTVVDDMPTRLKLIYAGVTEIITQFQ
PDFFAIEQVFMAKNPDSALKLGQARGAAIVAAVNLNLPVSEYAARQVKQTVVGTGAAEKS
QVQHMVRSLLKLPANPQADAADALAIAITHCHLSQNTLRLGNDQMTLSRGRIR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgtattaggtatcgaccccggttctcgtgttaccggctatggtgttatccgc
cagcaaggtcgtcaacttacgtatctgggcagtggctgtatccgcactgtggttgacgat
atgcctactcgcttgaagttgatatacgcaggtgtgaccgaaatcattacgcagtttcag
ccagatttttttgctatcgaacaagtctttatggcaaaaaatccggactcggcattaaaa
ctggggcaagcgcgtggcgcggccattgtggcggcagtaaacctcaatttacctgtctct
gaatacgccgcacgtcaggtaaaacagacggttgtagggaccggcgcggcagaaaaaagc
caggtccagcacatggtgcgctccctgcttaaattaccggcgaatccacaagcggatgcg
gcggatgcattagctatcgccattacacattgtcatctgagccaaaatacgttgcgtttg
ggtaatgaccaaatgacattatcacgtggccggatacgctga

DBGET integrated database retrieval system