KEGG   Yersinia pestis A1122: A1122_15920Help
Entry
A1122_15920       CDS       T01831                                 

Definition
(GenBank) copper homeostasis protein CutC
  KO
K06201  
copper homeostasis protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3434968..3435732)
Genome map
AA seq 254 aa AA seqDB search
MTKLEVCCYSVDCAQIAEKAGADRVELCCGQSEGGVTPSVGALMQARETVTIPVHPIVRP
RGGDFCYSSNDFTIMKNDIARIRDLGFAGVVVGVLDTDGHIDMPRMREIMSVSGSLAVTF
HRAFDMCQNPMIALKQLAELNVARILTSGQQQNAELGLALLKDLVAATKDQGPIIMAGAG
VRLTNMQKFIDAGIRELHSSAGRTVPSTMRYRKAGVTMCADSDVDEFSHYCVDGEVVEAM
KSLLVMGSPLAKHT
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattggaagtttgttgctatagcgttgattgtgcacaaatagcagaaaaggca
ggagccgaccgggttgaattgtgctgtggtcagtctgaagggggggtgacgccgagtgtc
ggcgcattaatgcaggccagagaaaccgtgactatcccggttcatccgatagttcggcca
cgtggtggtgatttttgttacagcagcaatgattttactattatgaaaaatgatattgcg
cggatccgtgacttgggctttgctggcgtcgtcgttggcgtactggatacggatgggcat
atcgatatgccacggatgcgggagattatgtcagtaagtggttcactggcggtaaccttc
catcgcgcatttgatatgtgccaaaatccgatgattgccttaaagcaattggctgaactt
aatgtggcgcgtattttaacctcagggcagcagcaaaatgctgaattgggtttagctctg
ttgaaagatttggttgcagcaaccaaggatcaaggcccgattattatggcaggggccggg
gtgcggttgacgaatatgcagaagtttattgatgcagggattcgtgaattacacagttct
gccgggcggacggtgccatcaaccatgcgataccgtaaagccggggtgacgatgtgcgcc
gacagtgatgtcgatgagttttctcactattgtgttgatggtgaggtcgttgaagctatg
aagagtttattggttatggggtcgcctcttgccaagcacacctag

DBGET integrated database retrieval system