KEGG   Yersinia pestis A1122: A1122_15935Help
Entry
A1122_15935       CDS       T01831                                 

Definition
(GenBank) putative hemolysin
  KO
K11016  hemolysin
Organism
ypt  Yersinia pestis A1122
Pathway
ypt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    A1122_15935
Secretion system [BR:ypt02044]
 Type V secretion system
  Two-partner secretion (TPS) family
   A1122_15935
Bacterial toxins [BR:ypt02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   A1122_15935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fil_haemagg_2 Haemagg_act Big_3_5
Motif
Other DBs
NCBI-ProteinID: AEL73808
Position
complement(3439119..3443729)
Genome map
AA seq 1536 aa AA seqDB search
MRGNEHIPSVYNNPDGVSVINIAPPSEHGLSHNQYMEFHVNEHGVVFNNSLERVVKNGLT
YDANLNLRGSPARVILNEVVGPNASVLAGHQDIVGIPADYILANANGISCQGCSFAPEFK
NVTLAVGKVVTVRGDLRSIDTIGNANLLNVSNDRDDNNMADALTLIAPVISTNGHIKVKG
DADFVVGQNMYHFMKDKTPEVEAGNSKIKTIDGYYLGSISANRINLVDTREDNNINLFGD
VTAEETKVVTSGTLRLRAAEDGRQDITIKNGMNISANKIDTTREFTADEVKLFDIKENKV
NKTIINAGRIDFVAVEDVKLAGTTILSNDDLSITAKSLHVDSHLIKHSQDTGVVVTHVNI
LDAPTKKVEIKNNDHVSQASAIMSRKNVKLHGQDGLELKNANIQAYGNIKLSSEGDIHLN
GSTETNTTINNITYINYDEDLKRGHNNVETVTERFAPLDMKARGNIDIQSKNTHIHGAKI
ASEGELSIDAKGDVYIGLASMLTSEFKDIDYNMWGGAHGSEKDKIEEYVYTGNKSDLVGG
RVKITAGNDARILGGKINGVDSGEISAQNYLSIDGVLGTRSFKRDQKTGGIMHTNESAST
SQNHYEKFIDSEISSDGDFRIFSQKDLYIDGSRINVNGKLDINANEKLTVQAARQQQKID
EEKTRLSIEWFAKESSDKQYRAGILINHQKDTENTLRDEHQIATLSAEQINITAGDDIKF
FGTGISTSKGDVIIKTPKNVGFFTAKNRALINKNQVNNSGGFYFTSGMDKTGNGLQYTHI
DKESYSDIENNLVVKTHIKGDLNINAGGDLNQQGTQHDVAKNYSVEASNINNMASNNLAF
SKTDTLQVDVSIGNNIDHSGMTRPIEKVIKDPANTLDYIGGRGSQKGVSDPTIGLDVDVS
GSRTKTSDNDALALVTSIKAQDIKQVAKKDVLDEGTQYHATEGGMSLQGARHFSRAAVNS
KANTTEQEKGEVSLRGGMTATQEIKGHLGVKAETSQGDSYAEEMLVGNINAKSGVSIKTT
GDAYYYATNIEGGNGDITIDAGNNLYFDQVQDSQRSSNIKFSGHGKLSLGGSSGSKEFRL
EGGGGYQQGRSQRTDAIVSKINTQGNVTLKAGADLTTKGMQIGKQGTRASDVSLLAAGEV
KLLAAVSGSADINDSALADFRLGGKRATGGASKEGFVGAGVQADKVNQSVSDRQGGHIYS
KNTVSIKSDSDSNQAIHLEGLKIDAPKVDLSAQQGGVFIESALSELPKDNWNFGFNLDMV
LKNTSPKKEDGTIDKDKASESHYKGAGIKVMVDKQDMFKHQNAHINTAYFSLNTKKDAVM
KGARIESTRADVNVGRDLTIESLKSKEDSVKVDVELSLSHTNDKSSSVTSKLSKVTLKKF
EKRTQEKLDSGIKDIGLMYNNKVKPKDTMGGVGFSKESQGVYLPTLSSETKSRNFADKTA
RYLGGQLKGIASGPEGLDGRAKLDVQIVNNDAVAEQSGIFGIDETNISVKGTTKLHGAEI
SSGSGQLTLETENRELSNIKNSTHKGGVGLMFLLVY
NT seq 4611 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtaatgaacatatcccaagtgtttataataatcctgatggtgtgagtgtgata
aatatcgctcctccgtcagagcatggtctctcgcataatcaatatatggaatttcatgtt
aatgaacatggggtagtgtttaataattcacttgagcgagttgtaaaaaatggattgact
tatgatgctaaccttaatttacgtggctcaccagcacgtgtgattttaaatgaagtggtg
gggccaaatgcttcagtattggctgggcaccaggatatcgtaggcatacctgcagactat
attctggcaaatgctaatgggattagctgtcagggatgtagttttgcgccagagtttaaa
aatgtcacgttagccgtagggaaagtcgttacggttcgtggtgatctacgcagtatagac
accatagggaatgctaatttattgaatgtgtcaaatgatcgcgatgataataatatggct
gatgcattgacactcattgcaccagttattagcactaatggccacattaaagtcaaaggc
gatgcggattttgttgtgggccaaaatatgtaccattttatgaaagataaaactccagag
gtagaagcaggtaatagtaaaataaaaacaattgatggctactatcttggcagtatttcc
gctaaccgtattaatttagttgacacaagggaagataataacattaatttatttggtgat
gtgaccgcagaggaaaccaaggtggtcacctctggcacgttgcgattaagagcggcagaa
gacggcaggcaggatataaccataaaaaatggaatgaatatatcggcgaacaagattgat
actacacgggaatttactgctgatgaagtgaagttatttgacataaaagaaaataaagtc
aacaaaaccattattaatgctggccgtattgattttgttgctgtcgaagatgttaaattg
gcaggtactacaattttaagtaatgatgatctctcaattacggcaaagagtttacatgtt
gactcacatttaattaagcattcacaggatacaggagtggtagttactcatgtgaatatt
cttgatgcgccaactaagaaagtagaaattaaaaacaatgatcatgtttcgcaagccagt
gcaattatgagtcggaagaatgttaaattacatgggcaggatggtttagaactgaaaaat
gccaatatccaagcctatggtaatattaaattgtcttctgaaggtgatattcatttaaat
ggttcaactgaaactaatactacaataaataatattacctatattaattatgatgaggac
ttgaaaagaggtcataataatgtagaaaccgtcactgaaaggttcgcccctcttgatatg
aaggcgagggggaatattgatatacagagcaaaaacacgcatatccatggtgccaaaata
gcttcagagggtgagttatcaatagatgctaagggtgacgtctatattgggctggcaagt
atgttaacttcagagtttaaagatattgactacaatatgtgggggggggctcatggttcg
gaaaaagacaagatagaagagtatgtttataccggcaataagtcagatttagtcggaggg
cgggtaaaaatcactgcgggtaatgatgccagaatactcggtggaaaaataaatggagta
gatagtggagagatctcggctcaaaattatctgagtattgatggtgtgttggggacacgc
agctttaaaagggatcaaaaaactggtggtataatgcataccaacgagagtgcttctact
tcccaaaatcactatgaaaaatttatcgacagcgaaattagttctgatggcgatttccgc
atattcagtcaaaaagacctttatattgatggtagtcgaattaatgtaaacggaaagcta
gatattaatgctaatgagaagttgaccgtacaggctgctcgtcagcaacaaaaaatagat
gaggaaaaaacccgcctcagcatagagtggtttgctaaagaaagcagtgataaacagtat
cgtgcgggtattctcattaatcatcaaaaagacactgaaaatacactgagagatgaacac
caaattgcaacattaagtgcagaacagattaatatcactgccggagacgatattaaattc
tttggcactggtatcagtacttctaagggtgacgtgataataaaaacacccaaaaatgtt
ggatttttcaccgcaaaaaaccgtgcactaatcaataaaaatcaggttaataatagtggg
ggtttttatttcacgtcagggatggataaaacaggtaatggcttacaatatacccatatt
gacaaagaaagttacagcgacattgagaataatctggtcgttaaaacgcatattaagggt
gatttaaatattaatgcaggaggcgatcttaatcagcaagggacgcagcatgatgtggct
aaaaactattcagttgaagcctcgaatattaataatatggcgagcaataatcttgctttc
tccaaaacagatacattacaggttgatgtcagcatcggtaataatattgatcacagcggg
atgacccgtccaatagaaaaagtcattaaagatccggctaatacgcttgattatatcggt
ggcagaggaagccagaaaggtgtttcagacccaacgattggtctggatgtggatgtatca
ggcagtcgaaccaaaacgtcagacaatgacgcgttagcgttggttacctcgattaaagcc
caagacattaagcaggtggcgaaaaaagatgtgctggatgaagggacccaatatcacgct
accgagggcggtatgagtttacagggggcacgtcatttcagccgtgccgcagtaaacagt
aaagcaaatacaacggagcaagaaaaaggtgaagtaagtcttcgggggggcatgacggcc
actcaggagataaaaggccatctgggggttaaggcggagaccagccagggtgacagctat
gctgaagagatgttggtcgggaatattaatgccaagtcgggggtttctatcaaaacgacc
ggggatgcctattattatgcgacgaatattgaggggggaaatggggatataaccattgat
gcgggcaataatctttattttgaccaggtacaggatagccaacgcagcagtaatataaaa
ttttcgggtcatggcaaattgagtctcggtggctcttctggcagcaaggagtttcgcctt
gaagggggcgggggctaccaacaaggtcgaagccagcgcactgacgctattgtaagtaaa
atcaatacacagggtaatgtaacgctcaaagcgggcgcggatcttactacaaaaggtatg
cagatcggcaagcaaggaacccgggcaagcgatgtctctttgttggcggctggagaggtc
aaactgttggccgcggtgtctggcagtgccgatattaatgatagtgcgctggctgacttc
cgtctgggggggaaacgagcaacaggcggtgcttcaaaagaaggttttgtgggagcaggc
gttcaggctgataaagtcaatcaatcggtttctgaccgtcagggcggccatatttatagt
aagaatacggtgtctataaaatcagacagtgacagcaatcaagccatccatttagaaggg
ttaaaaattgatgcaccaaaagtcgatttgagtgcgcaacagggtggggtatttatcgag
tctgcattaagtgaattgccaaaggataattggaattttgggtttaacctggatatggtc
ctgaaaaacacatcgcctaaaaaagaagatggaacaattgacaaggataaagccagtgaa
agtcattataaaggtgctggcattaaagtaatggtggataaacaagatatgtttaaacat
cagaatgcgcatatcaacactgcatatttttctttgaataccaaaaaagatgcagtaatg
aaaggggcacgaattgagagcacgcgggctgatgttaacgtgggccgggacctgacgatc
gaaagcctcaagagtaaggaagacagtgtcaaggtggatgttgagttatcgctaagccat
accaatgataaaagcagtagcgttacatctaaactctcgaaggtcacgctcaagaagttc
gagaaacggactcaagaaaagttagactcaggtattaaagacattgggttaatgtataac
aacaaagtaaaaccaaaagatacgatgggcggggtcggtttcagtaaagaatctcaagga
gtatatcttccaacattatcttctgagacaaaatcccgtaattttgctgataaaacggca
cgctatctgggcggtcaattgaaggggatcgccagcggcccagaaggccttgatgggcgt
gcgaagttggatgtacaaatagtaaacaatgatgcggttgctgaacaatccggtattttc
ggtattgatgagacgaatatttcggtaaaagggaccaccaaactacacggcgcggaaata
agtagtggatcagggcagctcaccttggaaacagagaacagggaactgagcaatataaaa
aatagtactcataaggggggggtgggtttaatgtttctcctagtgtattag

DBGET integrated database retrieval system