KEGG   Yersinia pestis A1122: A1122_15950Help
Entry
A1122_15950       CDS       T01831                                 

Definition
(GenBank) putative oxidoreductase
  KO
K03810  
virulence factor
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3447814..3448725)
Genome map
AA seq 303 aa AA seqDB search
MKKLRVGIVGLGGIAQKAYLPILTQAQGWQLVGAFSPNQAKAQPLCDSYRMRYFSRLDTL
AAASDAVFVHSSTASHFQVVHDLLQAGVHVYVDKPLAETREQSEQLIELADKQHLALMVG
FNRRFAPLYQQLKQQASSPVSLRMEKHRLSSIGPHDLGFTLLDDYLHVVDTALWLGGEGA
RLTGGAVQTNAQGQMLYAEHHFQQGGCLITTSMHRQAGTQRESVQVISDGACYHITDMRQ
WQQASAGQVISQPAPGWQTTLEQRGFTGAVHHFIEAVSNQTRPQVSGEDAIVAQRMIERI
LQQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactacgcgtgggtatcgtggggctggggggcattgcgcaaaaggcttatttg
cctattttaactcaggcgcagggttggcaactggttggcgcattttcacccaatcaagct
aaagctcaaccgctatgtgatagctatcgtatgcgttatttttcacgcttggatacgctc
gctgcggcaagtgatgccgtttttgtccatagtagtaccgccagccattttcaggtcgtg
catgatttattgcaggccggagtccatgtctatgtggataaacccctggctgaaacacga
gagcaatcagagcaattgatcgaactggcagataaacagcatttagcgctgatggtgggt
tttaatcgccgttttgccccgttatatcagcagttgaaacaacaggcgagcagcccggtc
tcactgcggatggagaagcaccggctaagtagcatcgggccacacgacttaggttttacc
ttgctcgatgactatctgcatgtcgtggatacggcgctgtggctaggcggtgagggggca
agattgacgggtggggcagttcagaccaatgctcaggggcagatgctgtatgcggagcac
catttccagcaaggtggttgtttgatcaccaccagtatgcaccgtcaggccggaactcag
cgggaaagcgtacaagttatcagtgacggtgcctgttatcacattaccgatatgcgccaa
tggcagcaggcgtcagcggggcaggtgataagccaacctgctcccggctggcaaacgaca
ttggaacaacgtggttttaccggggctgtgcatcatttcattgaggcggtcagtaatcaa
acgaggccgcaagtctcaggtgaagatgcgattgttgcacaacgtatgattgagcgtatt
ttgcagcagtag

DBGET integrated database retrieval system