KEGG   Yersinia pestis A1122: A1122_16095Help
Entry
A1122_16095       CDS       T01831                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ypt  Yersinia pestis A1122
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ypt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3474807..3475706
Genome map
AA seq 299 aa AA seqDB search
MTTANQPICPSPAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQ
IRLLTPIAGVENEQNLIVRAAKMLQKHPGNTPVPRGADISIDKCLPMGGGLGGGSSNAAT
VLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQPAEPVEKWYLVI
HPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYA
PSRLTGTGACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRSGKIESSERR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcgaatcaacctatatgtccgtcaccagcaaaatggccgtcaccggcaaaa
ttgaatttgtttctttatatcaccgggcaacgcgccgacggctatcatcagttacaaacg
ctgtttcaatttcttgattatggtgatcaactgacgattgaaccgcgcgatgacaaccaa
attcgcttattaacccccatagcaggggtggaaaatgagcaaaacctgatcgtccgcgcg
gcaaaaatgctgcaaaaacaccctggcaatacccccgtgccacgcggtgctgatatcagc
attgataaatgtttaccgatgggcggtggattggggggcggttcgtctaatgcagccaca
gtcttggtggcactcaacctactgtggcaatgtggtttaactgatgaacaattagccgat
ctcggactaacattaggggctgatgtcccggtatttgttcggggccatgccgccttcgca
gagggtattggtgaaaaattacagccagcagagcctgtagagaagtggtatttggtcata
caccccggtgtaaacatcccaacaccgattattttttctgatcctgaattaaaaagaaat
acgccaatccgcccactggcggcgcttttaagcactccatacgcaaatgattgcgaaccg
atcgcaagaaaacgttttcgcgaggttgaacaggctctttcatggctgttagaatacgcc
ccgtcacgccttaccggtaccggcgcttgtgtgtttgcagaattcgacacggagtcatcg
gcccggcaggtgttaagtattgcccctgagtggttacatggttttgtcgcccgtggtgta
aatgtttcaccattgcatcgtgtacgctcagggaaaattgaaagcagtgagcgcagataa

DBGET integrated database retrieval system