KEGG   Yersinia pestis A1122: A1122_17805Help
Entry
A1122_17805       CDS       T01831                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ypt  Yersinia pestis A1122
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A1122_17805
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    A1122_17805
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A1122_17805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3820547..3821578)
Genome map
AA seq 343 aa AA seqDB search
MGPVMLDVASYELDAEEREILKHPLVGGLILFSRNFHDAEQLRELVRQIRAASHERLVVA
VDQEGGRVQRFRDGFTRLPAAQYFAAINDAATAAQLAQEAGWLMAAEMMAMDIDISFAPV
LDIGHVSAAIGERSFHSDPQQARIMAECFIRGMHSAGMKTTGKHFPGHGAVTADSHKETP
HDNRPLAEIRTHDMVIFRELIQRKLLDAIMPAHVIYTEADARPASGSAYWLQEILRQELG
FEGIIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSPIKADQL
TRLYHSGQFDRQTLMASSRWQQANKALTALSERWDAHKQTLGQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcccgtgatgttagatgttgccagctatgagctggatgctgaagagcgtgagatt
ttaaaacacccactggtgggagggttgatcttattcagccgtaattttcatgatgcggag
cagttacgcgaattagtacgccaaatccgtgcagcatcgcatgaacgtttggtggtcgca
gtggatcaggaaggggggcgggtccaacgctttcgtgacggttttacccgcctgccagcg
gctcagtatttcgcggctatcaatgatgccgctactgcggctcaactggcgcaagaggcg
gggtggttgatggcagcagaaatgatggcgatggatatcgatatcagttttgctccagta
ctggatattggccatgtcagcgccgcaattggtgagcgttcattccacagtgatccacaa
caggcgcggataatggcggagtgtttcatccgtgggatgcacagtgcagggatgaaaacc
acgggcaagcattttccagggcacggcgcagtaaccgcagattcacataaagagacgcca
catgataatcggccactggcagaaatccgtactcatgatatggttatatttcgtgaattg
atccagcggaaattactggatgcgattatgcctgctcacgtgatttataccgaagccgat
gcacggcctgccagcggttctgcctattggttacaagagatattgcgccaagagctaggg
ttcgagggcatcattttctctgatgatctctcgatggaaggggctgcgatcatgggcagt
tacgccgagcgcggccaggcatcgttggatgccggttgcgatatgattttggtgtgtaat
aaccgtcagggggccgtgagtgtgctggataatctgtctccgatcaaagccgaccaactg
acccgtttgtaccattcagggcaatttgaccgccagacattgatggcttcatcccgttgg
caacaggcgaataaagcattaacggcactcagcgaacgttgggatgcacataaacaaacg
ttggggcaatag

DBGET integrated database retrieval system