KEGG   Yersinia pestis A1122: A1122_18200Help
Entry
A1122_18200       CDS       T01831                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00040  Pentose and glucuronate interconversions
ypt00052  Galactose metabolism
ypt00500  Starch and sucrose metabolism
ypt00520  Amino sugar and nucleotide sugar metabolism
ypt01100  Metabolic pathways
ypt01130  Biosynthesis of antibiotics
Module
ypt_M00362  Nucleotide sugar biosynthesis, prokaryotes
ypt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A1122_18200
   00052 Galactose metabolism
    A1122_18200
   00500 Starch and sucrose metabolism
    A1122_18200
   00520 Amino sugar and nucleotide sugar metabolism
    A1122_18200
Enzymes [BR:ypt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A1122_18200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEL74257
Position
complement(3903181..3904074)
Genome map
AA seq 297 aa AA seqDB search
MTKLKAVIPVAGLGMRMLPATKAIPKEMLPIVDKPLIQYVVNECVAAGINEIILITHSSK
NAVENHFDTSYELEAMLEARVKRQLLDEVQSICPPGVTIMHIRQGHPEGLGHAVLCAKPL
VGDSPFVVLLPDVLIDDEQSDLTRDNLAQLVQRFEETGVSQVLVHSVDPETLSNYSVVSC
EKSTLLPGESSRINAMIEKPQSSADLQSNLSAVGRYVLSAHIWPLLEQTKPGAWGRIQLT
DAIDALAAVEAVDAVALTGKSYNCGEKLGYMQAYVAYGLRHPQQGAEFKAWLKDFVA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattgaaagcagtcatccctgtcgctggtttaggcatgagaatgctcccggcg
accaaagctattccgaaagagatgttgccaatcgttgataagccacttatccagtatgtg
gtgaacgaatgtgttgctgcgggcatcaacgaaattattctgataacccattcatccaag
aacgccgtagaaaaccattttgatacttcctatgaattggaagcgatgctggaggcccgt
gttaagcgccagctattggatgaagtgcagtcaatttgcccaccgggtgtgacaataatg
catattcgtcaggggcatccagaggggttgggccacgctgttttatgcgccaaaccgtta
gtgggtgattcgccatttgttgtcttgctgccagatgttctaattgatgatgagcaatct
gatttaacccgcgataatctggctcaattagtgcaacgttttgaagagaccggggtcagc
caagttttggttcattcggtagatcctgaaacgctgtctaattattcggtggtttcctgt
gagaaatcgaccttgttgccaggggagagcagccggattaatgccatgatcgagaagcca
caaagttcggcagatttacaatcaaatctgtctgcggtggggcgctatgtactgtcagcg
catatttggccattgttggaacagacgaaacccggcgcttgggggcgtatccaactgacc
gatgctattgatgctttggctgcggtagaggcggttgatgcggttgccttaaccggtaag
tcctataactgcggtgagaaactcggctatatgcaggcttatgtggcttatggtttgcgt
cacccacagcaaggggctgaatttaaggcatggctaaaggatttcgtcgcgtaa

DBGET integrated database retrieval system