KEGG   Yersinia pestis A1122: A1122_19405Help
Entry
A1122_19405       CDS       T01831                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00020  Citrate cycle (TCA cycle)
ypt00190  Oxidative phosphorylation
ypt00650  Butanoate metabolism
ypt01100  Metabolic pathways
ypt01110  Biosynthesis of secondary metabolites
ypt01120  Microbial metabolism in diverse environments
ypt01130  Biosynthesis of antibiotics
ypt01200  Carbon metabolism
Module
ypt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1122_19405 (sdhD)
   00650 Butanoate metabolism
    A1122_19405 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    A1122_19405 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEL74495
Position
4175787..4176134
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system