KEGG   Yersinia pestis D182038: YPD8_0074Help
Entry
YPD8_0074         CDS       T01833                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00010  Glycolysis / Gluconeogenesis
ypx00030  Pentose phosphate pathway
ypx00051  Fructose and mannose metabolism
ypx00052  Galactose metabolism
ypx00680  Methane metabolism
ypx01100  Metabolic pathways
ypx01110  Biosynthesis of secondary metabolites
ypx01120  Microbial metabolism in diverse environments
ypx01130  Biosynthesis of antibiotics
ypx01200  Carbon metabolism
ypx01230  Biosynthesis of amino acids
ypx03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPD8_0074 (pfkA)
   00030 Pentose phosphate pathway
    YPD8_0074 (pfkA)
   00051 Fructose and mannose metabolism
    YPD8_0074 (pfkA)
   00052 Galactose metabolism
    YPD8_0074 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    YPD8_0074 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YPD8_0074 (pfkA)
Enzymes [BR:ypx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YPD8_0074 (pfkA)
Protein phosphatases and associated proteins [BR:ypx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YPD8_0074 (pfkA)
Messenger RNA biogenesis [BR:ypx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     YPD8_0074 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACY60764
Position
88350..89333
Genome map
AA seq 327 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSD
MINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGDGSYAGADLLTKEGGIH
CVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDDIDSLAKYIEKET
GRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDHDYKKGGFCVGVQNEKMVHE
LISVCIAPENKKSKFKEDWYDTAKKLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaattggtgtcctaacaagtggtggtgatgcacccggtatgaatgctgct
attcgcggggttgttcgtgccgctttgtcagcagggttagacgttttcggtattgaagat
ggctatcttggcttatatgaaaatcgtatgaagaagctggatcgctatagcgtgtcagat
atgattaaccgtggcggtactttcctcggatctgctcgtttcccagaattccgcgatccg
gaagtgcgtaaagttgccctcaagaatatgcatgagcgtggcattgatggcttggttgtt
atcggtggtgatggttcttatgctggtgcggacctgctgacaaaagaagggggaattcac
tgtgttggtttaccgggcactatcgataacgatgtggcgggtactgactacaccatcggt
tttttcaccgcactggaaacggtagtggaagccattgaccgcttacgcgatacctcttct
tcccaccaacgtatctctatcgtggaagtgatgggccgctattgcggtgatttaacgttg
gcagccgcgattgccggtggttgtgagtttattgcgatccctgaagttgaatttaaacgt
gatgatctggttgctgaaatcaaagcgggcatcgcgaaaggtaaaaagcacgcgattgtt
gctattactgaaaagctggatgatatcgattcattggctaagtacattgaaaaagagacg
ggccgtgaaactcgtggcaccgtgttaggccatatccaacgtggtggtgctccggtggct
tatgaccgtattcttgcttcccgtatgggggcttatgctgtcgatttgctgttacaggac
cacgattacaaaaaaggtggtttctgcgtcggtgtacagaatgagaagatggtgcatgag
ttaatttctgtgtgtatcgcgccagagaataagaaaagtaaatttaaagaagattggtac
gatacagcgaagaaactgttctaa

DBGET integrated database retrieval system