KEGG   Yersinia pestis D182038: YPD8_0115Help
Entry
YPD8_0115         CDS       T01833                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ypx  Yersinia pestis D182038
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPD8_0115 (malQ)
Enzymes [BR:ypx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     YPD8_0115 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
137479..139575
Genome map
AA seq 698 aa AA seqDB search
MDRKSLDQAATLAGIAASYINAHGKPQATLAETKEQLLAAMGRSLGAHDTQTANTPLPVV
KVFTFGSPMQLPMAGSGDYHWQLQTENGELHQGRISAKKTLTLPASLPLGYHRLILEQDL
QQWQCSIIVAPKRCYEPDALLQGKKLWGACVQLYTLRSEHNWGIGDFGDLKQMLEQVGER
GGSFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDINRVEEFQQSEAAQRWWHQAET
QQALAKSRESEWVDYPLVMQLKLTALRLSFPLFTARKAKDAQVQAFRHFVEQGGSSLHQQ
AVFDALHAHLSEHDPMMWGWPVWPEKYRDGHSSAVADFCREHADEVTFYLWLQWLAASQF
DDCFQSSQQRKMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGL
PPMDPHVMVARAYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGHTADQGAYVKYPV
DDLLAVLALESQRHHCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLYFEHDSENIFRAPQS
YPVQAMATITTHDLPTLRGYWQADDLTLGNKLGLYPDQQILKQLYLDRERAKQGLLEGLH
RYDCVPKKVGHKAALLSMSPVLNRGLQRYVADSASALLGLQPEDWLDMAAPVNIPGTTDE
YPNWRRKLSASLEEIFADSQINRLLKDLDKRRKNVSVG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaaatcgctcgatcaagcagcaacactggcagggatagctgccagttacatt
aatgcgcatggtaaaccgcaggcgacgttagcggaaaccaaagagcagttgttggcggcc
atggggcgttctcttggtgctcatgacactcagacagcgaatacccctttgccggtcgtt
aaagtgtttacgtttggtagcccgatgcaattgccaatggccggttctggcgattatcac
tggcagttacagactgagaacggtgagctgcatcaggggcgtatcagtgcgaaaaaaacg
ctgacattgccggcctctttgccgctgggttatcaccgtttgatattggaacaagattta
cagcagtggcagtgttcaatcatcgtggcaccgaaacgctgctatgagcctgatgctttg
ctgcagggaaaaaaactgtggggggcttgcgtacaactgtataccctgcgttccgagcat
aattggggtatcggtgactttggtgatttaaagcagatgttagagcaggtcggtgagcgt
ggtgggtcctttatcggtttaaaccctatccatgcgttatatccggccaacccgcatagt
gctagcccttacagcccgtcatcccggcgctggttgaatgtgatttatatcgacatcaat
agggtcgaggagtttcagcaaagtgaagccgcgcagcgttggtggcatcaagctgagacg
caacaggcgttggcaaaaagtcgggagagcgagtgggttgattacccgttagttatgcag
cttaaattgacggctttgcgcttatccttcccactgtttactgcccgtaaagccaaagat
gcacaggtgcaggcatttcggcactttgttgaacaaggcgggagcagtttacatcagcag
gccgtatttgatgccctacatgcgcatttaagtgagcatgatccgatgatgtggggctgg
ccagtgtggccagagaagtaccgtgatggtcatagtagtgcggtggctgatttttgtcgc
gaacacgctgacgaggtgacgttctatctgtggttacagtggttggcagccagtcaattt
gatgactgcttccaatccagccaacagcggaaaatgccgattggtctgtatcgtgatttg
gcggttggggttgctgaaggtggcgctgaaacctggtgtgaccgcgagttatattgcctg
aaagcatcagtaggtgccccgccagatatcttggggccattaggccagaactgggggcta
ccgccgatggaccctcatgtaatggtcgcgcgcgcgtatcagccttttattgatttactg
cgtgccaatatgaccagttgtggcgcattgcgcatcgaccatgtcatggcattattgcgt
ctgtggtggatcccctacgggcataccgccgatcagggggcttatgtaaaatacccagtg
gatgatttgctggcggtattagcgctggagagtcagcgccaccattgcatggtgattggt
gaagatttaggcacggtaccggtagagattgtgggcaagttacgtgatagcggggtgtat
tcctacaaggtgctctattttgagcatgacagtgagaatatcttccgtgcgccacagtct
tacccggtgcaggcgatggcgaccattacgacccatgatttgccgacactgcgcggttac
tggcaagctgatgatctgactttggggaataagctggggttatatccggatcaacagatt
ttgaagcagctctatcttgacagagagcgagccaaacaagggttattagaagggttacat
cgttacgattgtgtgccgaaaaaagtgggccacaaagcggcactgttatcgatgagccca
gtactgaaccgtggtttgcagcgctatgttgcggatagcgccagtgcattgctggggtta
caaccagaagattggttggatatggcagcaccagtgaatatccccggtaccactgacgag
taccctaactggcggcgtaaattgtcagcgtctctggaagagatatttgccgatagccag
attaatcgtttattgaaagatttggataagcggcgcaaaaacgtttcggttgggtaa

DBGET integrated database retrieval system