KEGG   Yersinia pestis D182038: YPD8_0366Help
Entry
YPD8_0366         CDS       T01833                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ypx  Yersinia pestis D182038
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPD8_0366
   00500 Starch and sucrose metabolism
    YPD8_0366
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     YPD8_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
441889..442743
Genome map
AA seq 284 aa AA seqDB search
MTLKGEERDTTVIGANTAAGMLNPQGTKWGTSGSSTVLVNAANFTAENLTIRNDFDFPAN
QAKAEGDPTKLKDTQAVALLLAEKSDKARFRQVKLEGYQDTLYSKTGSRSYFTDCDISGH
VDFIFGSGVTVFDRCNIIARDRRDISPPYGYITAPSTQNTAPYGLIVLNSRLTKEPGVPA
KSFALGRPWHPTTAFDDGRYADPAAIGQAVFINTVMDDHIYGWDKMSGKDKQGEKVWFYP
QDSRFFEANNQGPGAEINEGRRQLSAEQLKAFTLPMIFPDWTVQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaaaggtgaggagcgtgatacgacggtgattggcgcgaataccgccgcgggt
atgctcaacccacaagggacgaagtggggaacctctggcagcagcacggtattggtgaat
gccgccaattttactgcagaaaatttgacgattcgtaatgacttcgatttccctgctaat
caggcgaaagcagagggtgatccgacgaaattaaaagatacgcaggcggtggcgctgtta
ttagcagaaaaaagtgataaagcccgtttcaggcaagtcaaacttgaggggtaccaagat
acgctttatagcaaaacgggcagtcgtagctactttaccgattgtgacatcagtggccac
gtcgattttatttttggctcaggggtgacggtatttgaccgctgcaatattattgcccgt
gatcgccgtgatatctccccaccttacggttacattacggcacccagtacccaaaatacc
gcaccttatggtctgattgtcctcaatagtcgtttaaccaaagaaccaggtgtgcctgct
aaaagttttgccttagggcgcccgtggcaccctactacagcatttgatgatggccgttat
gctgatcctgcggctatcggacaggcggtatttatcaataccgtaatggatgatcatatt
tatggctgggataaaatgtctggaaaagataagcaaggcgagaaagtttggttctacccg
caagactctcgcttctttgaagcgaacaatcagggaccaggggctgaaattaatgagggg
cggcgtcagttgtctgctgagcaactaaaagcgttcacattgccaatgatttttccagac
tggaccgttcagtaa

DBGET integrated database retrieval system