KEGG   Yersinia pestis D182038: YPD8_0377Help
Entry
YPD8_0377         CDS       T01833                                 

Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypx  Yersinia pestis D182038
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPD8_0377
Enzymes [BR:ypx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YPD8_0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455935..456570
Genome map
AA seq 211 aa AA seqDB search
MHSRLKACCVAISESACGRLSSHIPVKQGDALFLAQEIIRKKRDGQPLSEEEIRFFINGI
RDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLNWKSLNLNGPLVDKHSTGG
VGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFRKIIMLV
WRLSAKPARWPLPISVFTRPAILRQQSILFH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtaggctgaaggcctgctgtgtcgctatttccgaaagcgcctgtgggcggctt
tcatcccatattccggtcaagcagggggatgccttgtttctggcacaagaaattatccgt
aaaaaacgcgacggtcagccattgagcgaagaagagattcgtttttttatcaatgggatc
cgcgataacgttgtttctgaagggcaaattgccgctttagcgatgaccatttatttccac
gacatgagcatgcctgagcgcgttgcgctgaccatggcgatgcgtgattccggtactgtg
ctgaattggaagagcctgaatctgaatggcccgctggtcgataagcactccactggtggc
gtgggtgatgtgacgtcactgatgcttggcccgatggtggcagcctgcggcggctatgtg
ccgatgatctctggccgtggtcttggtcataccggcggcacactggataaactggaggcg
atccccggttttgatattttcccggatgataatgcgttccgcaaaattattatgttggtg
tggcgattatcggccaaaccagctcgctggcccctgccgataagcgtttttacgcgaccc
gcgatattacggcaacagtcgattctattccattga

DBGET integrated database retrieval system