KEGG   Yersinia pestis D182038: YPD8_0378Help
Entry
YPD8_0378         CDS       T01833                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypx  Yersinia pestis D182038
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ypx00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
456567..457346
Genome map
AA seq 259 aa AA seqDB search
MITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSADLAQAIVGVANGAGCKTTALLTD
MNQVLASSAGNGVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAHDEADARAKLQ
AVLDNGKAAEVFGRMVAAQKGPADFVERYDSYLPVATLSKPVFAEQTGIITAMDTRALGM
AVVALGGGRRRATDPIDYSVGLTEMARLGTRVDGQQPLAVIHANNEDDWQQAAEVVRAAI
TLGNNTPEETPVIYRRITE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgattacggcctctattctggccaaaaaattggcggaagggctggatgcattggtcatg
gacgtgaaggtcggctccggtgcctttatgccaacctactcgttgtcggctgatttggcg
caggcgattgttggtgtggcaaacggtgcgggttgcaaaaccacggcgctactgacggac
atgaaccaagtcctggcgtccagcgccggtaatggggtcgaagtccgcgaagctgtgcgt
ttcctgacgggcgaatatcgcaacccacgtttgctggaagtgactatggcgctgtgtgtt
gaaatgttgctgtcaggcggtttagcgcacgatgaagccgatgcccgtgccaagctgcaa
gccgttttggataatggcaaagcggcggaagtctttggccgtatggtggccgcgcaaaaa
ggcccggcagactttgttgaacgctatgacagctacctgcccgttgctaccctaagcaaa
ccggtatttgctgaacagacgggaatcattactgcaatggatacccgcgccttgggtatg
gcggtggtcgccctcggcgggggacgccgtcgggcaacggatcccattgattatagtgta
gggctgacggagatggcccgtttgggtacccgtgttgatgggcagcagccgcttgcggtg
atccatgccaataacgaagatgactggcagcaggcggcagaggttgtgcgtgcggccatc
accttagggaataacacgccagaagaaacgccagtgatttatcgccgtatcactgaataa

DBGET integrated database retrieval system