KEGG   Yersinia pestis D182038: YPD8_0401Help
Entry
YPD8_0401         CDS       T01833                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ypx  Yersinia pestis D182038
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPD8_0401 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPD8_0401 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YPD8_0401 (thrC)
Enzymes [BR:ypx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YPD8_0401 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
484626..485915
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGSEIAPDVLTKRVQAAFEFPAPVAQVENDIAVLELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIDGDFDACQALVKQAFDDEELKTALSLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWPRVEELYRRKIWQLKDLGHGAVSDKTTKDTMRELAGLGYISEPHAAIAYRV
LRDQLQDGEFGLFIGTAHPAKFKESVEAILGQELPLPKPLAVRAQLPLLSHDLPADFAQM
RAFLMALPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcataacgagcaggtcagcttcgcacaggcgatcaaa
caaggcttgggcaaacagcaggggctatttttcccgttggagttgcccgagttcgaactg
actgagatcgataaactgctggatctggattttgtgacccgtagtagccgcattctgtcg
gcttttattggtagtgaaattgcaccagatgtcttaaccaaacgtgtgcaggcagctttt
gaattcccagcccctgttgcacaagttgaaaatgatatcgccgttctggagttgttccac
ggcccgaccttggcgtttaaagactttggcgcacgttttatggcacagatgctggccgaa
gttgctggcgatcaacccgtcactattttaacggcaacatcgggtgatactggtgcggcg
gtggctcatgcattctacgggctgaaaaatgttcgagtggttatcctttatccacgaggc
aagattagtccgctgcaagaaaagctgttttgtactctgggcggtaatattcacacggtg
gcgattgatggcgattttgatgcttgtcaggcactggttaagcaagcttttgatgatgaa
gaactgaaaaccgcgctgagtttgaattccgctaactcaattaatatcagccggttactg
gcacaaatttgttactactttgaagctgtagcccagttaccacaagaggcgcgcaaccaa
ctggttatctctgtaccaagcggtaactttggtgatttgactgccggtttgttggcaaaa
tctttagggctaccggtgaaacgctttattgctgccactaatgctaacgacaccgtgcca
cgctttttggttaacggccagtggcagccaaagccaactgtagccacgttatcgaatgcc
atggatgtcagtcagccaaataattggccacgtgtggaagagctatatcgtcgcaaaatc
tggcagttgaaggatttagggcatggtgcggttagcgataaaaccacaaaagatacgatg
cgtgaattagctggtttggggtatatctctgagcctcacgcggcgattgcttaccgtgta
ttgcgtgatcagttgcaagatggtgaatttggcttgtttatcggaaccgcacatcccgcg
aaattcaaagagagcgtagaggcaattctgggtcaggaattacctttaccaaaaccactg
gccgtgagagcgcaattaccgttgctatcccatgatttgcccgcagactttgcacaaatg
cgggcatttttgatggcattgccgaagtaa

DBGET integrated database retrieval system