KEGG   Yersinia pestis D182038: YPD8_0482Help
Entry
YPD8_0482         CDS       T01833                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ypx  Yersinia pestis D182038
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ypx00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ypx00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591860..592972
Genome map
AA seq 370 aa AA seqDB search
MLAQWSQALGETSAVMGTVGNGLLGQVIPTENTTGSAVDIQHLLRNLVDQGATFAAMEVS
SHGLIQDRVAALSFAAVVFTNLSRDHLDYHGNMTSYEAAKWLLFSTHQSEHKIINADDDV
GRRWLSQLPQAVAVSMAGNVPKGWNGPWLSANKVIYHDNGASIAFDSSWGEGELESRLMG
AFNVSNLLVALATLLVQGYPMAQLLAAAPHLQPVCGRMEVFNAPGKPTVVVDYAHTPDAL
EKALAAARLHCTGKLWCVFGCGGDRDKGKRPLMGGIAEQLADCVVVTDDNPRSEEPQAIV
ADILSGLLDAGRVQAIHGRAEAVTSAIMQAKEDDVVLIAGKGHEDYQLVGNRRLDYSDRV
TVARLLGGQA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgttagcacaatggagccaggcgctgggcgaaaccagtgcagtcatgggcaccgtaggt
aatggtttattagggcaggtgatacccacggagaacaccaccggttctgccgtagatatt
caacatttgctgcgtaatctggttgatcaaggtgcgacttttgccgccatggaagtttct
tcccacggtttgattcaagaccgtgttgctgcgttatcctttgcagccgtagtgttcact
aacttaagccgcgatcatctggattatcacggcaatatgacgagctatgaggcggccaaa
tggctgctgttctccactcatcagtccgaacacaaaattatcaatgctgatgatgacgtt
ggccgccgttggttaagccaattgccgcaggctgtcgccgtcagcatggcaggcaatgtc
cccaaaggctggaatggcccgtggttatctgccaacaaggtgatttatcacgataatggt
gccagcatcgcgtttgattcaagctggggcgaaggcgagctagaaagccgtctgatgggc
gctttcaacgtcagtaacttgttggtggcattagcgacgttactggttcaggggtatccc
atggcgcagttgttagctgcagcgcctcatctgcaaccggtttgtgggcgtatggaagtg
tttaatgcgccgggtaaaccaaccgttgtggtggattatgcccacacgccagatgcatta
gaaaaagccttggccgccgcccgtttacattgcaccggcaagctgtggtgtgtgtttggc
tgtggcggtgaccgtgataaaggtaagcgcccacttatgggcggtatcgcagaacaactg
gctgactgtgtcgtggtgaccgatgataacccacgcagtgaagagccacaggcgattgtt
gctgacattctcagtggcttgctggacgcggggcgtgtgcaggcgatacatggccgtgcc
gaagccgtaaccagtgccattatgcaagccaaagaagacgacgttgtcctgattgccggt
aaaggccatgaagattatcaattagttggcaatcgtcgcttggattattcagaccgtgtc
accgtcgcgcgtttgttaggggggcaggcatga

DBGET integrated database retrieval system