KEGG   Yersinia pestis D182038: YPD8_0813Help
Entry
YPD8_0813         CDS       T01833                                 

Gene name
bgaB
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ypx  Yersinia pestis D182038
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YPD8_0813 (bgaB)
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     YPD8_0813 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1059795..1061855
Genome map
AA seq 686 aa AA seqDB search
MSKFPPLSAKVSALLHGADYNPEQWENYPDIIDKDIAMMKQAKCNVMSVGIFSWVKLEPS
EGEYNFSWLDELIEKLYAAGIHIFLATPSGARPAWMSQKYPEVLRVGRDRVPALHGGRHN
HCMTSPVYRQKVRQINQKLAERYAHHPAVIGWHISNEYGGECHCHSCQQKFRLWLQDRYQ
TLDNLNEAWWSAFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQVTEFCSEEAKP
LKAANPELPVTTNFMEYFYDYDYWKLAQVIDFISWDSYPMWHREKDETQLACYTAMYHDL
MRTLKQGRPFVLMESTPSATNWQPTSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRVGREVSELGRILEAMSPVMGSKVDADVAIIFDWESRWAMDDA
EGPRNCGLEYEKTVAEHYRPFWERGIAVDIINADCDLSGYKLVIAPMLYMVREGFAERAT
RFVEQGGQFVATYWSGIVNESDLCHLGGFPGPLRPLLGIWSEEIDCLADGESNQVQGLAG
NKAGLQGPYQAIHLCDLIHLEGATAVARYRDDFYADRAAVTVNFVGEGKAWYVASRNDAA
FQRDFFMNIAEELNLARALDTQFPYGVTAHRRTDGESEFIVVENYSNDSKSLVLPAVYRD
MVDQQPVQGSLTLAPWGSRVLTRYLE
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtttccgcccttaagcgcgaaagtttctgcgttattgcatggcgctgactat
aacccagagcaatgggaaaattatcctgacattattgataaagatattgccatgatgaaa
caggcaaaatgcaatgtcatgtcagtgggaatattcagttgggtaaaacttgagccaagt
gaaggagaatataatttctcttggttagatgaattaattgaaaaactttatgctgccggt
atccatatattcctggcgacgccaagtggcgcacgtccggcttggatgtcgcagaaatat
cctgaagttttacgtgtcgggcgtgatcgggtgcctgcgctgcatggtgggcgtcataac
cactgtatgacctcgccggtatatcgccagaaagtgcggcagataaaccagaagttagca
gagcgttacgcccatcatcctgcggttattggctggcacatctctaatgaatacggcggc
gaatgtcactgtcattcctgtcagcaaaaattccgcctctggcttcaggatcgttatcaa
acgctggataaccttaacgaagcctggtggagtgctttctggagccacacctacagcgat
tggtcgcaaattgagtctccagcaccgcaaggtgaagtttcaattcatggtctgaacctt
gactggcggcgttttaataccgctcaggttacggagttttgttctgaagaggctaagcca
ctaaaggcggcaaacccagagttgcctgttacgactaactttatggagtacttctacgat
tacgactactggaagttggcgcaggtgattgattttatctcctgggacagctacccgatg
tggcatcgtgagaaagatgaaacgcagcttgcctgttataccgcgatgtatcatgacctc
atgcgtaccctgaaacagggccgtccatttgtcttaatggaatcaacgccaagcgcgacc
aactggcaacctaccagtaagttgaagaagccggggatgcatatcctctcttctttacag
gctgtcgcgcacggtgcggatgcggtgcagtatttccaatggcgtaagagccgtggctcc
gttgagaagttccacggtgcggttgtcgaccatgttggccacattgatacccgtgttggg
cgggaggtgagcgaactgggtcgtatactcgaggccatgtcgccggtgatgggaagtaaa
gtagacgctgatgttgccatcatttttgattgggaaagtcgttgggctatggacgacgcc
gaaggcccacgtaattgtggcttggaatatgagaaaaccgttgccgagcattaccgtcca
ttctgggaacggggcattgcggtcgatatcattaacgctgactgcgatctgtcgggttac
aagctggtcattgcaccgatgctctatatggttcgcgaagggtttgctgaaagggcgacg
cgttttgtagagcaaggtgggcagtttgtcgcgacctactggagcggtattgtcaacgaa
tctgacctgtgtcatctcggtggcttccctggccctctgcggccgctgttgggtatctgg
tccgaagaaattgactgtctggccgatggcgagagcaatcaagtccaaggacttgcaggc
aataaagccggtctacaggggccttatcaggccatccatctctgcgatttgattcatctt
gaaggggcgacagccgtcgcgcgctatagagatgacttctatgctgaccgtgcggcggtg
accgtaaactttgttggcgaaggtaaagcctggtatgtcgcttcacgtaacgatgcggct
ttccagcgtgatttcttcatgaacattgccgaggagctaaacttggcacgtgcgctagac
acccagttcccttatggggttaccgctcaccgtcgtaccgatggtgagagtgaatttatc
gtggtagaaaactacagtaatgacagcaaatcgctggtgttacctgcggtataccgcgat
atggtcgaccagcagccggtacaaggtagcctgacgcttgccccatggggaagccgagtg
ctaactcgctatctcgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system