KEGG   Yersinia pestis D182038: YPD8_1165Help
Entry
YPD8_1165         CDS       T01833                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00020  Citrate cycle (TCA cycle)
ypx00190  Oxidative phosphorylation
ypx00650  Butanoate metabolism
ypx01100  Metabolic pathways
ypx01110  Biosynthesis of secondary metabolites
ypx01120  Microbial metabolism in diverse environments
ypx01130  Biosynthesis of antibiotics
ypx01200  Carbon metabolism
Module
ypx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPD8_1165 (sdhD)
   00650 Butanoate metabolism
    YPD8_1165 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    YPD8_1165 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACY61850
Position
complement(1506203..1506550)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system