KEGG   Yersinia pestis D182038: YPD8_1165Help
Entry
YPD8_1165         CDS       T01833                                 

Gene name
sdhD
Definition
succinate dehydrogenase cytochrome b556 small membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ypx  Yersinia pestis D182038
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPD8_1165 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPD8_1165 (sdhD)
   00650 Butanoate metabolism
    YPD8_1165 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    YPD8_1165 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1506203..1506550)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system