KEGG   Yersinia pestis D182038: YPD8_1326Help
Entry
YPD8_1326         CDS       T01833                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypx01100  Metabolic pathways
ypx01110  Biosynthesis of secondary metabolites
ypx01130  Biosynthesis of antibiotics
ypx01230  Biosynthesis of amino acids
Module
ypx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YPD8_1326 (trpC)
Enzymes [BR:ypx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YPD8_1326 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     YPD8_1326 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI CEP44 QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACY62011
Position
complement(1700540..1701967)
Genome map
AA seq 475 aa AA seqDB search
MQETGGYKTEGYNVGSDKVDSDKTKTVLHQIVHDKEIWVAARKLQQPLTRFQNEITQSQR
DFYHALQGDKTVFILECKKASPSKGVIRDNFNPAEIAGVYKHYASAISVLTDEKYFQGSF
DFLPQVSAAVTQPVLCKDFIIDAYQIQLARFYHADAILLMLSVLDDEAYRQLAAVAHSLN
MGVLTEASNAEELERAITLGAKVVGINNRDLRDLSIDLNRTRELAPRLPEGVTIISESGI
SHYRQVRELSQFANGFLIGSALMSEPDLNAAVRRVLLGENKVCGLTRAQDAATAYHAGAV
YGGLIFVDSSPRYVDIASARTVISGAPLKYVGVFRHAEIETVRQTAEQLSLAAVQLHGHE
DQQYINQLRKVLPADCQIWKALSVGDTMPERNLQQVERYVLDHGTGGTGQRFDWSLLADQ
ALDNVLLAGGLGPDNCDVAAQLGCAGLDVNSGVESAPGIKDPQRIAAVFQALRVY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaactgggggttacaaaaccgagggttataacgttggcagtgacaaagttgac
agtgataaaaccaaaaccgtgctccaccaaatcgtacacgataaagaaatttgggttgcc
gcgcggaaactgcaacagcctctaacccgcttccaaaacgaaatcacccagagtcagcgc
gatttttatcacgcgctacaaggcgataaaacggtctttattttggaatgcaaaaaagcc
tcaccttctaaaggggttatccgtgacaactttaacccggcggagattgccggtgtttat
aagcactatgcgtcggctatctcagtattaacggatgagaaatatttccagggcagtttt
gatttcttgccacaagtcagtgccgccgtcactcagccggtattgtgtaaagattttatt
attgatgcttatcagattcagctagcgcggttttaccacgctgacgccattttactgatg
ctgtcggtcttggacgatgaggcttaccgccaattggccgccgtcgcacacagcctgaac
atgggggtgttgaccgaagccagtaacgccgaagaattggagcgtgctattaccttgggt
gccaaagttgttggcatcaataaccgcgacctgcgtgacctgtctatcgatctgaatcgc
acccgtgaattggcaccacgcctaccagaaggtgtcacaataatcagtgaatctggcatt
agtcattatcgtcaggtccgtgaattgagccaatttgccaacggtttcctgattggcagt
gccctgatgtccgaacccgatctcaacgcggccgtccgccgggtgttactgggcgaaaat
aaagtttgcggcctgacacgcgcacaagatgccgccacggcttaccacgcaggtgcggtg
tacggcgggttgatttttgtcgacagttcaccccggtatgtggatatcgccagcgcccgt
acggttatcagtggtgcgccgctaaagtatgtcggtgtttttcgtcatgctgaaatagaa
actgtacggcaaacggctgaacaactctcactggcagcagtgcaattgcatgggcatgaa
gatcaacagtatatcaatcaactgcgcaaagtattacctgcggattgccagatttggaag
gcactgagtgtcggtgacacgatgccggaacgcaacttacagcaagttgaacgctacgta
ttggatcacggtacgggtggcacagggcaacgtttcgactggtcattattggcagatcaa
gcactagataatgtcttgctggcaggcggcttggggccagataactgtgatgtggcagcc
caactaggctgtgccgggctggatgtcaattccggcgtagaaagcgcccctggcatcaaa
gacccccaacggatcgccgctgtattccaggcattacgcgtgtactga

DBGET integrated database retrieval system