KEGG   Yersinia pestis D182038: YPD8_1568Help
Entry
YPD8_1568         CDS       T01833                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ypx  Yersinia pestis D182038
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPD8_1568 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    YPD8_1568 (hisD)
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     YPD8_1568 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2002664..2003995
Genome map
AA seq 443 aa AA seqDB search
MQPTNFNTLINWQQCSEEQQKALLSRPAINASERITAAVSDILDRVKAEGDSALRDFSQR
FDHVQVADIRITASEIAAASARLSDDVKHAMAQAVRNIEIFHNAQKMPVVDVETQPGVRC
QQITRPIASVGLYIPGGSAPLPSTVLMLGTPARIAGCQRVVLCSPPPIADEILYAAQLCG
IQEVFQIGGAQAIAAMAFGSESVPKVHKIFGPGNAYVTEAKRQVSQRLDGAAIDMPAGPS
EVLVIADSGATPAFIAADLLSQAEHGPDSQVILLTPDAAIAQAVAVEVEQQLALLSRADI
ARQALESSRLIVTNDLQQCIDISNAYGPEHLILQIRQPEEIIDQIDNAGSVFMGDWSPES
AGDYASGTNHVLPTYGYTSTYSSLGLADFVKRMTVQQLTPQGLLGLASTIETLAQAEQLT
AHKNAVTLRVTALNNALTAVNKE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgacgaatttcaataccctgatcaattggcaacaatgcagtgaagaacagcaa
aaagcgctgttgagccgcccagccatcaatgcatccgagaggatcactgcggcggtcagt
gacatcctggaccgggtgaaagcggaaggcgatagcgccctgcgtgattttagccagcgt
tttgaccatgtgcaggtcgcggatatccgtatcactgcatcagagatcgctgcggcctcg
gcgcgcctgagtgacgatgtcaagcacgccatggcacaggcggtacgtaatattgaaatc
ttccacaatgcgcagaaaatgccggtggtggatgttgaaactcagccgggtgtgcgttgt
cagcaaatcacgcgtccgattgcttccgtcggcttgtatattcccggtggttctgcaccg
ttgccatcaaccgtactgatgctcggcaccccagcacgtattgccggttgtcagcgggtc
gttttatgttctccaccgcctattgccgatgaaattttgtatgccgctcaactgtgcggt
attcaggaagtgttccagatcggcggggcacaagcgatcgccgccatggcattcggcagt
gaatcggtgcctaaagtgcacaaaatttttgggccgggcaacgcttatgttactgaggca
aaacgtcaggttagccagcgcctggacggtgctgccatcgatatgcccgcaggcccatca
gaggtgttggtgatcgccgacagcggtgctacacctgcgtttatcgcggcggatttactc
tcacaagcggaacacgggcctgattctcaagtgatcttactgacacctgatgccgctatc
gcacaagcggtggcagtcgaagttgagcaacaactcgcgctgttatcccgagccgatatt
gcccgtcaggcactggaaagcagccgtttgatcgtgaccaacgatttacagcaatgcatt
gatatcagtaatgcatacggccctgagcatttgattctacaaattcgtcaaccagaagaa
atcattgaccagattgataacgctggctccgtgtttatgggcgattggtcaccggaatcg
gctggggattacgcctcgggcaccaaccacgtactgccaacctacggttatacctcaacc
tattccagtttaggtttggctgattttgttaagcgcatgaccgtacagcaattgacacca
cagggtttgttagggctggcctccaccatcgaaacactggcacaggccgaacaactgacc
gcacacaaaaatgcagttaccctgcgcgttaccgccttgaataacgccctgaccgccgtg
aataaggagtaa

DBGET integrated database retrieval system