KEGG   Yersinia pestis D182038: YPD8_1632Help
Entry
YPD8_1632         CDS       T01833                                 

Gene name
adhE
Definition
(GenBank) aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00010  Glycolysis / Gluconeogenesis
ypx00071  Fatty acid degradation
ypx00350  Tyrosine metabolism
ypx00620  Pyruvate metabolism
ypx00625  Chloroalkane and chloroalkene degradation
ypx00626  Naphthalene degradation
ypx00650  Butanoate metabolism
ypx01100  Metabolic pathways
ypx01110  Biosynthesis of secondary metabolites
ypx01120  Microbial metabolism in diverse environments
ypx01130  Biosynthesis of antibiotics
ypx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPD8_1632 (adhE)
   00620 Pyruvate metabolism
    YPD8_1632 (adhE)
   00650 Butanoate metabolism
    YPD8_1632 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    YPD8_1632 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    YPD8_1632 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YPD8_1632 (adhE)
   00626 Naphthalene degradation
    YPD8_1632 (adhE)
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YPD8_1632 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     YPD8_1632 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ACY62315
Position
2085816..2088491
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFSQEQVDKIFRAAALAAADARIPLAKLAVTESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILCEDKTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKDATNKAADIVLQAAIAAGAPADIIGWIDAPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DNGVICASEQSIIVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGGLNAAIVGQP
ATKIAEMAGIKVPSNTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKNFEEAVEKAEKLV
EMGGIGHTSCLYTDQDNQTARVKYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQVTSVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKLVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYNEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIQKLLAWLDEIKAELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILMDTYYGREYVEEFDREEEVAAATAPKAEKKTKK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaatgtcgctgaacttaacgagctagtagcacgcgtcaagaaagcccag
cgcgagtatgccaacttttcgcaagagcaagttgataaaatcttccgtgctgcagcatta
gccgctgcggatgcccgtattccactagccaaactggctgtaacagagtctggcatgggt
attgttgaagacaaagtgatcaaaaaccactttgcttctgaatatatttacaatgcttat
aaagatgaaaaaacctgtggtattttgtgtgaagataagaccttcgggacgatcactatc
gcagaacctattggtctaatctgcggtatcgtaccaaccactaaccctacgtctaccgct
atttttaaagcactgattagcttgaagacacgtaacggtattatcttctccccacatcca
cgcgctaaagacgcaaccaataaagctgcggatatcgtgcttcaagccgctatcgcagca
ggtgcgccagcggatattattggttggattgatgctccaacagttgaattatctaatcaa
ctgatgcatcacccagacattaatcttattctggcaaccggtgggccaggtatggttaaa
gcggcctatagctctggtaaaccagccatcggcgtaggtgcgggtaatacgccagtcgtc
gttgacgaaactgcagatattaaacgtgttgtcgcatctattctgatgtctaaaaccttt
gataacggtgttatctgcgcgtcagagcagtccatcatcgttgttgactcggtttacgat
gcggttcgcgagcgttttgcttctcatggtggctacctgttacaaggtaaagaattgaaa
gccgttcaggatattatcctgaaaaatggcggtctaaacgcagccatcgtgggccagcca
gcaactaagatcgctgagatggctggcattaaagtgccaagtaataccaagatacttatc
ggtgaagtcaaagttgtcgatgaatcagagccatttgctcatgaaaaactgtcgcctaca
ctggcaatgtatcgtgctaaaaactttgaagaagcggttgaaaaagcagagaaactggtg
gagatgggcggtatcggtcatacctcttgtctgtacaccgaccaagataaccagactgca
cgcgttaaatatttcggcgataaaatgaagaccgcccgaattctaatcaacacccctgcc
tctcaaggtggtatcggtgacttgtataacttcaagctggcaccgtctctgacgctgggt
tgtggttcttggggtggtaactccatctctgaaaacgtcggtccgaaacacttgatcaac
aagaaaactgtggctaagcgagcagaaaacatgttgtggcataaactaccgaaatctatt
tacttccgtcgcggctctctgcctatagcgttggaagaagtggcaactgacggtgcaaaa
cgtgccttcatcgtgactgaccgctacttgttcaacaacggttatgcagaccaagtcacc
agcgtactgaaatctcacggtattgaaactgaagttttcttcgaagtagaagctgaccct
accctgagtatcgtgcgtaaaggtgcagagcagatgaactccttcaagccagacgttatt
attgctctgggtggtggttcaccgatggatgctgcaaaaatcatgtgggtaatgtacgaa
catcctgaaacgcatttcgaagaactggcattgcgttttatggatatccgtaaacgcatt
tataagttcccgaaaatgggtgtaaaagcgaaattggtcgctattacaaccacatcaggt
accggttcagaagtcaccccgtttgctgtggttactgatgacgcaacaggccagaaatat
ccattggcagactatgcattgacaccagatatggccattgttgatgccaaccttgttatg
aatatgcctaagtctctgtgtgccttcggtggtctggatgcagtaacgcacgcactggaa
gcctatgtgtctgtactggctaatgaatactctgacggccaggcgctgcaagcactgaag
ctgttgaaagaattcttgccagccagctacaacgaaggggctaaaaacccagttgctcgc
gaacgtgtacataatgcagcaacaattgccggtatcgcctttgctaacgccttcttgggt
gtctgtcactctatggcccacaaactgggttctgagttccatatcccacacggcttggca
aatgctatgttgatttctaacgttattcgctacaacgcgaatgacaacccaacaaaacag
actgccttcagccaatatgaccgcccacaagcgcgtcgtcgttatgcagaaattgcagat
catttggggctgagtgcaccgggcgaccgtactgcacaaaaaatccagaaactgctggct
tggttagatgaaatcaaagctgaactgggtatcccggcatcgattcgcgaagcgggtgtt
caggaagctgacttcttagctaaagtagacaaattgtctgaagatgcatttgatgaccag
tgcacaggtgctaacccacgctacccactgatctcagagctgaaacagatccttatggat
acttattacggtcgcgaatatgttgaagagtttgaccgcgaagaagaagtcgcggcagct
actgcgcctaaagctgagaaaaagaccaaaaagtaa

DBGET integrated database retrieval system