KEGG   Yersinia pestis D182038: YPD8_2155Help
Entry
YPD8_2155         CDS       T01833                                 

Gene name
nuoF
Definition
(GenBank) NADH dehydrogenase I chain F
  KO
K00335  
NADH-quinone oxidoreductase subunit F [EC:1.6.5.3]
Organism
ypx  Yersinia pestis D182038
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    YPD8_2155 (nuoF)
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     YPD8_2155 (nuoF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2743016..2744401
Genome map
AA seq 461 aa AA seqDB search
MTINSGTTKEIIRTPEMHPLTWRLRDDKQPVWLDEYRSKNGYAGAEKALKGMAPTDVVNV
VKDAGLKGRGGAGFSTGLKWSLMPKDDSMNIRYLLCNADEMEPGTYKDRLLMEQLPHLLV
EGMLISAFALKAYRGYIFLRGEYIEAAVHLRRAIAEATEAGLLGKNIMGSGFDFELIVHT
GAGRYICGEETALINSLEGRRANPRSKPPFPASSGVWGKPTCVNNVETLCNVPAIIEHGV
EWYQGITAGKSNDAGTKLMGFSGRVKNPGLWELPFGITAREILEDYAGGMRDGLKFKAWQ
PGGAGTDFLTADHLDLPMDFENIAKAGSRLGTALAMAVDHEIGMVSLVRNLEEFFSRESC
GWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAHAPGAVEPLQSA
IKYFRDEFEAGIAVKAYESGMTSGNTRAIAGIQPNLLKARW
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaattcaggaacgaccaaggaaattatccggacgccagaaatgcacccgctg
acctggcgtttgcgcgatgacaaacagcccgtgtggctggatgagtatcgcagcaaaaac
ggctatgccggggcagaaaaagcgttaaaaggcatggcgcccactgatgttgttaacgtt
gtcaaagacgctggcctgaaagggcgtggcggcgcaggtttctccactggtttgaagtgg
agcctgatgcccaaagacgacagtatgaacatccgctatctgctgtgtaacgctgatgag
atggagccaggcacctataaagaccgtctgctgatggagcaattgcctcatctgctggtg
gaggggatgctgatcagtgccttcgcgctgaaagcctaccgtggctatatcttcctgcgt
ggcgaatatattgaagcggcagtgcatttacgtcgggcgattgctgaggccaccgaagcc
ggcttgctgggcaaaaacatcatgggcagtggttttgatttcgaactgattgtccatacc
ggtgcgggtcgttatatctgtggtgaagaaacggcgctgattaactcactggaaggccgc
cgtgctaacccgcgttctaagccgccgttcccggcctcttccggtgtctggggcaaaccg
acttgcgtgaataacgttgaaaccctgtgtaacgtaccggccattattgaacatggcgtt
gagtggtatcaggggatcactgccggtaagagtaacgatgccggaaccaaactgatgggc
ttctcgggtcgggtgaaaaatccgggtctgtgggaattgccgtttgggatcaccgcccgt
gagattctggaagattacgctggcggtatgcgcgatggcttgaaatttaaagcctggcag
ccgggcggggcgggtaccgatttcctgactgctgaccatctggatttgccgatggatttt
gagaatattgctaaagcaggtagccggttaggcaccgcgttggcgatggcggtagatcac
gaaatcggcatggtgtctttggtgcgcaatctggaagagttcttctcccgtgagtcttgt
ggctggtgtacaccgtgtcgcgatggtttgccatggagtgtgaagatcttacgtgcatta
gagcgtggtgaaggccagccgggtgatatcgaaacgctagagcaactgtgccgcttctta
gggccgggtaaaaccttctgtgctcatgcgccaggtgcggttgaacccctacaaagtgcg
attaaatatttccgggacgaattcgaagccgggatcgccgttaaggcctatgaatctgga
atgacgagcggcaacacccgagccatagccggtattcaacctaatctattaaaagcgcgc
tggtag

DBGET integrated database retrieval system