KEGG   Yersinia pestis D182038: YPD8_2167Help
Entry
YPD8_2167         CDS       T01833                                 

Gene name
idnO
Definition
(GenBank) gluconate 5-dehydrogenase
  KO
K00046  
gluconate 5-dehydrogenase [EC:1.1.1.69]
Organism
ypx  Yersinia pestis D182038
Brite
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.69  gluconate 5-dehydrogenase
     YPD8_2167 (idnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2757397..2758161)
Genome map
AA seq 254 aa AA seqDB search
MKNLFSLENRKVLITGSAQGIGFLLAKGLAEFGAEIIINDITAERAEKAVAELRASGFIA
HAAAFNVTNHDEVNEAIEKIESHIGAIDVLINNAGIQRRHAFTEFPEKDWDDVIAVNQKS
VFLVSQAVARYMVKRQRGKIINICSMQSELGRDTITPYAASKGAVKMLTRGMCVELARYN
IQVNGIAPGYFKTDMTKALVDDQAFTDWLCKRTPAARWGDPEELIGAAVYLSSKASDFVN
GHLLFVDGGMLVAV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctattttcgttggaaaatcgcaaagtattaattactggctctgcacagggt
attggattcttactggcaaaagggttagctgaatttggcgcagagattatcattaacgat
atcaccgcagagcgtgctgaaaaagccgtggctgaattacgtgctagcggctttatcgcc
catgccgccgcatttaacgtgacgaaccatgatgaagtcaatgaagctatcgagaaaata
gaaagccatattggtgctatcgacgtgttaattaataatgccggtatccaacgccgccat
gcctttaccgaattcccagaaaaagattgggatgatgtgattgctgttaatcaaaaatcg
gtatttttagtttcacaagccgttgcccgttatatggttaaacgccaacgtggaaaaatt
attaatatctgttcaatgcaaagtgaattaggccgcgatacgatcaccccgtatgccgcc
tctaaaggggcagttaaaatgctgacccgtgggatgtgtgtcgaactggctcgctacaat
attcaggttaacggtattgcaccgggttatttcaaaacggatatgacaaaagcactggtc
gatgatcaagcctttaccgattggttgtgtaaacgcacaccagccgcccgttggggagat
ccagaagagctcattggtgcagcggtttatttgtcatccaaagcctctgactttgttaat
ggtcatttgctgtttgttgatggtggcatgctggtagccgtttaa

DBGET integrated database retrieval system