KEGG   Yersinia pestis D182038: YPD8_2181Help
Entry
YPD8_2181         CDS       T01833                                 

Gene name
menE
Definition
(GenBank) O-succinylbenzoic acid--CoA ligase
  KO
K01911  
O-succinylbenzoic acid---CoA ligase [EC:6.2.1.26]
Organism
ypx  Yersinia pestis D182038
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Menaquinone biosynthesis, chorismate => menaquinone
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    YPD8_2181 (menE)
Enzymes [BR:ypx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.26  o-succinylbenzoate---CoA ligase
     YPD8_2181 (menE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2776274..2777689
Genome map
AA seq 471 aa AA seqDB search
MASLGHPPWEHWPWQYWANLRPQALAIRSGGQRISWQQLASDINALAAFFQQQGVVPGSG
VALRGKNSYTLLLAYLAALQCAARVLPLNPQLPDALLAQRLPTLDIHFMLNLATPLPPHF
AFTPLDPRTVDSAAVTPIAWDGQRLATLTLTSGSSGLPKAAVHSLGAHRANADGVLALMN
FTASDSWLLSLPLFHVSGQGIVWRWLTAGATLGVPEGVPLVEALAGCSHASLVPTQLWRL
LANAAPPLTLKEVLLGGAMIPTELTEQAEAHGIRCWCGYGLTELASTVCAKRADGRPGVG
VALAGRQVKLVDDEVWIKADCLAAGYWQQGQLLPLTDSDGWFHTRDRGRWQQGELCILGR
LDNLFFSGGEGIQPEDIERVLLQYSGVQHAFVIPVADAEFGHRPVAVIDSADEVDVVALA
DWLAPRLAVFQRPIAFYRLPTFLKRGGIKISRQQLADWLRGKYEGEKIGER
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgttaggccatccgccttgggagcattggccttggcagtattgggccaatctg
cggcctcaagcgctcgctatccgttctggggggcaacggatcagttggcaacagttagcc
agtgatatcaatgcgttggcggctttttttcaacagcaaggtgtggtgccggggagcggc
gtggccttgcgcggtaaaaacagttataccctgctattggcttatctggcggcattgcag
tgtgcagctcgcgttttgccgctgaatccgcaattgccggatgcgcttttggcgcagcgc
ctgccaacgctggatattcactttatgctgaatttagccaccccgttgcccccgcatttt
gcctttactccgttggatccccgcaccgttgattcggcagccgtgaccccgatagcgtgg
gatggccaacggctggcgacgctgacgctaacctcaggttcctccggcttaccgaaggcc
gcagtacactcgctgggcgcacatcgggctaatgccgacggcgtactggcgctgatgaat
ttcaccgccagtgatagctggttgctgtcgttaccgttgtttcatgtctcagggcagggg
attgtctggcgttggctgacggcgggggcgacactgggggtaccagagggcgtgccactg
gttgaggctttggcggggtgcagccatgcgtcattagttcccacgcaattatggcgtttg
ttggcgaatgccgccccccccttgacgttgaaagaggtactgttggggggcgcgatgatc
ccaaccgaactgaccgaacaggccgaggcccacggcatccgctgttggtgtggctacggc
ttgacggagttggcatcaacggtctgtgccaagcgggcagacgggcgacctggtgtcggt
gtcgcgctcgcaggccgtcaggtgaaactggtagacgatgaagtctggataaaagccgat
tgtctggctgccggttactggcaacaggggcaattactgccactcacggacagcgacggg
tggttccatacccgagatcgcggtaggtggcagcaaggcgaattatgtattctcgggcgg
ttggataatctgtttttcagtggtggcgaggggatccagccagaagacatcgagcgagtt
ttattgcagtattcaggggtgcagcacgcttttgttattcctgttgctgacgctgaattc
ggtcaccggccagtggcggtcattgattccgctgatgaggtggatgtcgtggctttagct
gattggttagccccacgattggctgtcttccagcggcccattgctttttaccggctaccc
acatttttgaagcgtggcgggattaagatctcaaggcagcaacttgccgactggctgcgc
ggcaagtatgaaggggagaagattggcgaaagatag

DBGET integrated database retrieval system