KEGG   Yersinia pestis D182038: YPD8_2182Help
Entry
YPD8_2182         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2777755..2778714
Genome map
AA seq 319 aa AA seqDB search
MDYSKIIKEVGRGKNHARDLDQPTAYALYKAMLAGQVPALELGGILIAFRIKGESEQEIL
GFYQAMQEQVMSLRAPVDRPLPVVIPSYNGARKQANLTPLLALLLSRLGLPVVVHGVTED
SSRVTSAEIFQQLNIPWSLSVQEAQQRLDNGLPVFIPVSALSMQLDQQLQQRWRMGVRNS
SHTLAKLATPFTHDKALRVASVSHPEYMQKVGGFFQAISAPGLLLQGTEGEVYANPLRCP
PIHYINDGEQTILLDRSSESVVPELPLSKDAVITARWIEGCLAGEQPIPDSILKQLACCL
VAAGQADSVELALQQIKIV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggattacagtaaaattatcaaagaggttgggcgcggtaagaaccatgcccgtgatctg
gatcagccaaccgcctatgcactgtataaagccatgttggcagggcaggtacccgcattg
gaattgggcggcatcctgatcgcctttcgtatcaaaggtgaatcagagcaggaaattctg
ggcttttaccaggcgatgcaagagcaggtgatgtcactacgcgccccggtggatcgccca
ttaccggtggtgatccccagctacaacggcgcgcgtaaacaggccaatttaaccccgttg
ctggcactgctgctgtcgcgtcttggtttgccggtcgtggtccacggcgtgacggaagat
agtagccgggttaccagtgcagaaattttccagcaactgaatattccctggtcgctaagt
gtgcaggaagctcaacaacgcttagataatgggctgcccgtatttatccccgtctccgca
ctgtctatgcaattggatcagcaattacaacaacgctggcgtatgggggttagaaacagt
agccacaccttggcaaagctggcaacaccgtttactcatgataaagcgttgcgcgttgcc
agcgtctctcatcctgaatatatgcaaaaagtgggggggttcttccaagcaattagtgct
ccggggctattgctacagggcaccgaaggcgaggtttatgctaatccactgcgctgccca
ccgattcattatatcaatgatggcgaacagacaattttactcgatcgttcatcagaatcg
gttgtccctgagttaccgttgtcgaaggatgccgtgattacggcacgttggattgaaggc
tgtctggccggagagcagcctattccagactcgattctaaaacagttagcttgttgtctg
gtcgcggcagggcaggctgattctgtcgaactggcgttgcaacaaattaagattgtgtaa

DBGET integrated database retrieval system