KEGG   Yersinia pestis D182038: YPD8_2188Help
Entry
YPD8_2188         CDS       T01833                                 

Gene name
glnP
Definition
(GenBank) glutamine ABC transporter permease component
  KO
K10037  
glutamine transport system permease protein
Organism
ypx  Yersinia pestis D182038
Pathway
ABC transporters
Module
Glutamine transport system
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    YPD8_2188 (glnP)
Transporters [BR:ypx02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamine transporter [MD:M00227] [OT]
    YPD8_2188 (glnP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2785633..2786289)
Genome map
AA seq 218 aa AA seqDB search
MQFEWSAIWPAIPLLLEGAKLTLWISVLGLLGGLIIGVIAGLARAYGGWLSSHIALVFIE
LIRGTPIVVQVMFIYFALPMMIPLRIDPFSAAVVTIIINSGAYIAEITRGAVLSIHSGFR
EAGLALGLSQRGTLLYVIAPLALRRMLPPLGNQWIVSIKDTSLFIVIGVAELTRQGQEII
AGNFRAMEIWSAVAVIYLIITLALSFVLRRLERKLKII
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgaatggagcgctatttggcccgccatcccacttctgcttgaaggtgccaag
ttgaccctatggatttccgtcctggggctacttggtggcctgattattggggtgatagcc
ggtcttgcccgcgcctatgggggttggctgagcagtcatatcgccttagtttttattgag
ttgatccgcggtacgcccattgtcgtgcaggtgatgtttatctacttcgcgctacccatg
atgataccgctacgtatcgatcctttctctgccgccgttgtgacgatcatcattaactcc
ggtgcctatatagcggaaatcacccgtggtgcggtgctgtctatccacagtgggttccgt
gaagctggtttggcactcggtctctcccaacgtggaactctgctttacgttattgcgccc
ctggcactgcgccgtatgttgccaccgctaggcaaccaatggatcgtcagtatcaaagac
acctcactgtttatcgtgattggcgtagccgaactgactcgtcagggtcaagagattatt
gccggtaatttccgcgccatggaaatatggagcgcggtggcggtgatctacctgattatc
acgctggcactgagcttcgttctccgtcggttagaaagaaaactgaaaataatatga

DBGET integrated database retrieval system