KEGG   Yersinia pestis D182038: YPD8_2196Help
Entry
YPD8_2196         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2793288..2794226
Genome map
AA seq 312 aa AA seqDB search
MTTLSEQAPPLLQDTQLEQQILRRSIFYTLIIAVMGIVFGIVCGSMSIIFDGMFSALDAG
MCSLSLLVSRLLGQPHSRRFQYGFWHVEPLVLAFNGSLLALLCLYAFVNAIKGIFDGGRE
LELGWAIVYTLAVSIFCFTIYLKQRRLNKRVKSELIALDTKSWFMSACISTALLVAFLLS
WGMEGTRYEHLIVYADPMVLALLTLVLIPVPIKTVIAAVREVLQMTPDTLDTAIETLMER
LVDKYKFVDYSHYATRAGRGLFIEIHVVIPPEMDTRGVHHFDTIRDEIAHEIGESGPHRW
LTISFTRDAKWL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacaacactcagtgagcaagctcctcctctactgcaggatactcagcttgaacagcaa
atcttgcgccgctcgattttttataccttgattattgcagtaatggggatcgtcttcggt
attgtatgtggctcaatgtcgattatctttgatggtatgttctccgccctggatgcgggg
atgtgcagtttatctctattggtatctcggctacttggtcaaccgcatagccgacgtttt
caatatggtttttggcatgtggaaccgttggttctggcctttaatggcagcttattagcc
ctcctttgtctttacgcttttgtgaatgcgataaaaggtatttttgatggcgggcgggaa
ttggagctcggttgggccattgtctacacattggctgtcagtattttttgtttcaccatt
tatttaaaacagcggcgcttgaataaacgggtgaaatccgagcttattgcattggatacg
aagagttggttcatgtccgcttgtatcagtacggcgctgttagttgcatttttactctca
tggggtatggaaggtacgcgctatgaacaccttattgtttatgctgaccccatggtactg
gcgctgttaacgttagtattaattccggtcccaattaaaacagtgattgcggcagtgcgt
gaagttttacaaatgacgcccgatacactggatacggcgattgagaccttgatggaacgc
ctggtggataaatataaatttgttgattactcgcattatgccacccgtgctggccgtggt
ttatttatcgagatccacgtggtgatcccgccagaaatggatacccgcggggttcatcat
ttcgatactatccgcgatgagatcgcccatgagattggtgagtctgggcctcaccgctgg
ttaaccatctcctttacgcgtgatgccaagtggttatag

DBGET integrated database retrieval system