KEGG   Yersinia pestis D182038: YPD8_2199Help
Entry
YPD8_2199         CDS       T01833                                 

Gene name
gutB
Definition
(GenBank) putative zinc-binding dehydrogenase
  KO
K00008  
L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ypx  Yersinia pestis D182038
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPD8_2199 (gutB)
   00051 Fructose and mannose metabolism
    YPD8_2199 (gutB)
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     YPD8_2199 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2796453..2797679
Genome map
AA seq 408 aa AA seqDB search
MILNVYVVISIFIMNAMSLLSVEVSNFTFVGLFKNDNVNIVSIHRVLLLLEELMSQLPEK
MSAVVCHGPQDYRLEHVPTPVPKAKELVIKVKGCGICAGDCKCKNGAKMFWGETPWVKPP
VVPGHEFYGHIVALGEGTESKYKLGERVIAEQIVPCWDCRYCNSGSYWMCETHNIYGFQK
DVAEGGMAEYMRFSENAIVHKIPESLSHEDAVLIEPMACAIHTVARGDIQLDDVVVLAGA
GPLGLCMVPVARLKTPKKLIVIDTIEERLALAKAFGADVVINPLKEDADKIVKSLTGGYG
CDVYIEATGAPIGVTQGLQMIRKLGRFVEFSVFGQETTVDWSIIGDRKELDIRGAHLAPY
SYEIATDLFERGLVTSKGIVTHSYSLDDWEKAFELADSTNSIKVILVP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgatactcaatgtttacgttgtcatttcaatatttattatgaatgcgatgtcattgttg
agcgttgaagtgagtaattttacttttgttggtttgttcaaaaatgacaacgtcaacatt
gtatccatacaccgagttctgttgctattggaggagttaatgagtcagttacctgagaaa
atgagcgctgtcgtatgtcacggcccgcaggattatcgtttagaacacgtgccgacacct
gtgccgaaagccaaagagttggtgatcaaagtgaaaggctgtgggatttgtgcaggtgac
tgtaaatgtaagaatggggcaaaaatgttttggggagaaaccccgtgggtaaaaccacca
gtggtaccgggacatgaattctacggccatattgtggcgctgggggaagggaccgaatca
aagtataagttaggcgaacgtgtgattgcggaacaaatagtcccttgctgggactgtcgc
tattgcaactctggcagctactggatgtgtgaaacgcacaatatctatggcttccaaaaa
gatgtcgcagaaggtggcatggcggaatatatgcgtttttctgagaatgccattgttcac
aaaatcccagagagcctgagtcatgaagatgcggtcctgatcgaacccatggcctgtgcg
attcatactgtggcaagaggggatattcaactggatgatgtggtcgtactggcgggcgcg
gggccgctggggctgtgcatggtaccggttgcccgcctgaagacaccgaagaaattgatt
gtcattgatactattgaagaacgcctggcactggcaaaagcctttggggccgatgtggtg
atcaacccactgaaagaagatgctgacaaaatagtgaaatctttgaccggtggctatggc
tgcgacgtttacattgaagcgacgggtgcgcccatcggtgtgactcaaggtttacaaatg
atccgcaagctggggcgttttgtggagttcagtgtctttggtcaggaaactaccgttgat
tggtccattatcggcgaccgtaaagaactggatattcgcggtgctcacctggcaccttac
agttatgaaattgccaccgatctctttgaacgtggtctggttacctcaaaaggtatcgtc
acccacagttattcattagatgattgggaaaaggcttttgagctagcggactccacgaat
tctattaaggtcattctggttccttaa

DBGET integrated database retrieval system