KEGG   Yersinia pestis D182038: YPD8_2202Help
Entry
YPD8_2202         CDS       T01833                                 

Gene name
rbsA
Definition
(GenBank) putative sugar transport system, ATP-binding protein
  KO
K10441  
ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
ypx  Yersinia pestis D182038
Pathway
ABC transporters
Module
Ribose transport system
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    YPD8_2202 (rbsA)
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     YPD8_2202 (rbsA)
Transporters [BR:ypx02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    YPD8_2202 (rbsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2798812..2800302
Genome map
AA seq 496 aa AA seqDB search
MTPLLELKQIKKSFPGVKALDGIDLTIQRGEVHALLGENGAGKSTLVKIMCGIYQPDSGG
IFLEGQRCRFANYRDAIDAGIGIIFQEFSLIPYMNTIDNIFLNREIKNRWGLLDRREMRR
KARAIFKRLTVDIDLDCPVEQLSVAQQQFVEIAKALSLDARILVLDEPTATLTPGEAEHL
FSIMHDLKLLGVGMVFISHHLDEIFTICDQITVLRDGAYIQTLPAAETNVEELVKLMVGR
KIENTFPVKSHPVDTSVRVLEATVQHTKHVMENSFHLYKGEILGFAGLVGSGRTELMSAL
IGARSCYQKSVSLNGQPTVLRNPAQALDHGIGLLPESRKTEGLVLPFSVAQNITLNRHEK
RGKIFVNAGKEHDIVQRLIRAVGVKTPDADTAVSTLSGGNQQKVVIARWLNNDCDILIFD
EPTRGIDVGAKSEIYQLMQQLTQKGISIIMISSELPEIIGVCDRVLVFRGGHIVAELAGD
EIESNNIMLHATGSAL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctttattagagttaaagcagataaaaaaatcttttccgggtgttaaagcactg
gatggaattgatctcaccattcaacgcggagaggttcatgcgttgctgggggagaatggg
gcaggcaaatctacactggttaaaataatgtgtggtatttatcagccagattctgggggg
atttttctggaaggtcaacgctgtcgctttgcgaattatcgtgatgccattgatgcgggt
attgggattatttttcaagagttctccctgatcccctatatgaatacgattgataatatt
tttcttaatcgagaaataaagaatcgttgggggttattagatcgccgtgaaatgcggcgc
aaggcccgcgctattttcaagcgcctgacggtggatattgatcttgattgccccgtggaa
caactcagtgtggcgcaacagcagtttgtcgagatagccaaagctctgtcgttggatgcg
cgcattctggtcttggacgaacccacggcgacgctgacaccgggtgaagccgaacattta
ttcagcatcatgcacgatctgaaattgctcggtgtcggtatggtgtttatttcgcatcat
ctggacgaaattttcacgatttgtgaccagatcacggtgctgcgtgatggcgcttatatt
cagacactgccggctgccgagactaatgtcgaagagctggttaagctgatggtcgggcgc
aaaatcgagaataccttcccggtgaaatcgcatccggtagacacctcggtgcgggtgctg
gaggcgacggttcagcacacaaaacatgtgatggaaaacagcttccatctgtataaaggc
gaaatattggggtttgccgggttggtggggtcaggccgtactgagctgatgtccgcactg
atcggtgcgcgctcctgctatcaaaagagtgtcagcctcaatggtcagcccaccgtgcta
cgtaatccagcgcaggcgttggatcacggtattggtctgttaccggaaagccgtaaaacc
gaagggctggtcttgccgttttccgtcgcccaaaacattacgcttaatcggcatgaaaaa
cgcggcaaaatcttcgttaatgcaggtaaagagcacgatatcgtgcagcgattaattcgc
gcggttggcgtaaagacaccggatgccgatacggctgtgagtaccttgagcggtggcaat
caacaaaaagtggtaattgcccgctggcttaacaacgattgcgacattcttattttcgat
gaacctacacggggtatcgacgtgggggccaagtctgaaatttatcaattaatgcaacaa
ctgacgcagaaaggcatatctatcatcatgatttcatccgaattaccggaaattattggc
gtttgtgatcgcgtcctggttttccgtggtgggcacattgttgccgaactggcgggtgat
gaaattgaatctaataacatcatgcttcacgcaacagggagtgcattatga

DBGET integrated database retrieval system