KEGG   Yersinia pestis D182038: YPD8_2208Help
Entry
YPD8_2208         CDS       T01833                                 

Definition
(GenBank) putative dioxygenase alpha subunit
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2807184..2808308
Genome map
AA seq 374 aa AA seqDB search
MSNQHPDFVLPKDFCANPREAYTIPAYFYTQQAAFEHEKERVFTNSWICMAHGSEVAQPN
DYITREIIGENIVIVRGRDSVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWTFKLDG
ELAHARNCENVTNFDKDRATLFPVRLEEYAGFIFINMNPDAESVEQQLPGLQDKVFEACP
DVHELKLAARFTTRTPANWKNIVDNYMECYHCEPAHPGFADSVQIDRYWHTMHGNWSLQF
GYAKPSEKSFKFEEGEESSFHGFWLWPCSMFNVPPLKGMMTVIYEFPVDAETTLQNYDIY
FTNEELTEDQKALIEWYRNVFRPEDLRLVESVQKGLKSRGYRGQGRIMADDKGSGISEHG
IAHFHNLVAKVFQE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaacatcctgactttgttttgccaaaagacttttgtgcaaacccgcgtgag
gcttacaccattcctgcttatttctatacccaacaggcggccttcgagcatgagaaagag
agggtatttactaatagctggatttgtatggcgcacggcagtgaagtggcgcagcctaat
gattacatcactcgtgagattattggtgagaacatcgttatcgtgcgtggacgtgatagc
gtattgcgggctttttataatgtctgtccgcatcgtgggcaccaattactcagtggggaa
ggtaaagcaaagaatgtcattacttgcccctatcatgcctggaccttcaagctcgacggt
gaactggcacatgcccgtaactgcgagaatgtcactaattttgataaagatcgggcgacg
cttttcccggtgcgcttagaggaatatgccggttttattttcatcaatatgaacccagac
gccgaaagcgtggaacaacaattgccgggcttacaggataaagttttcgaagcgtgcccc
gatgtgcacgagttgaaattggccgctcgcttcaccacccgtacccctgctaactggaag
aatattgtcgataactatatggagtgttatcactgcgagcctgctcacccaggattcgcc
gattcagtgcagattgatcgctactggcacaccatgcacggtaattggtcattacaattt
ggctatgcgaaaccctcagaaaagtcctttaaatttgaagagggtgaagagtcctctttc
cacggcttttggctatggccatgctcaatgttcaatgtgccgccactgaaaggcatgatg
accgtaatttatgagttcccagtcgatgcagaaacgacgctgcaaaactatgatatttat
tttacgaacgaagaactgacggaagaccagaaggcgcttatcgaatggtatcgcaatgtc
tttcgcccggaagatttacgcttggttgaaagcgttcagaaagggctgaaatcacgcggc
tatcgtggtcaagggcgtatcatggctgatgataaaggcagtgggatcagtgagcatggt
attgctcacttccataatctggtggcgaaggtctttcaagagtag

DBGET integrated database retrieval system