KEGG   Yersinia pestis D182038: YPD8_2210Help
Entry
YPD8_2210         CDS       T01833                                 

Definition
(GenBank) putative hemolysin activator protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2810022..2811710
Genome map
AA seq 562 aa AA seqDB search
MRYCYFILHTAILFPLLVISRAGQSAELTPIQQQTLHQQERQRALEERLAPPTPDVRLSA
PSASSDRLIFPVEKPCFVIDRVTLSGTEPLPRWLPLQRIANQALGQCLGGQGINQLMSQL
QNRLVGHGYVTTRVLAPQQDLNSGTLALQVVPGKIHRVALTPESDRHVTLFSAFPARPGH
LLDLRDIEQGLENLQRIPTVQASMELIPGSAPGETDIALSWKQSKMWRLAASLDDSGTRS
TGRYQGGATLFLDNPFSLSDQFYVSAGGSIKNRGDKGTNNLTGHYSLPFGYWTAGITASS
YDYHQTVAGLNSDYNYRGESENVSLQLSRLLHRNASQKTTLTYDVLTRSSKNYINDTEVE
VQRRRTSAWRIGLQHRHFISQATLDAGVSYQRGTRWFGAVPAQEEYFDEGTALSKILQLN
AQLDIPFSVMAQNFHYNVQYQRQSSSTPLTPQDQFSIGGRWSVRGFNGERTLSADRGWTV
RNDLGWYTPIQGQEIYVGLDYGEVGGRGSAYLLGNHLAGAAVGIRGNVLNTRYDLFAGKP
LSEPDGFQSDAVTVGFNLNWQY
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
ttgcgttattgttattttatattacacacggctatattatttccactgttggttatttct
cgcgccggacagagtgcggaattaacgcctattcaacagcaaactctccatcagcaagag
cggcagcgggcgctggaagaacgtctggctccaccgacgccagatgtgcgcttatctgca
ccttcggcctcttcggatcgccttattttccctgtggaaaagccctgctttgttattgac
cgcgtcacactcagcggcactgaaccgttaccccgttggttgccgttacagcgtattgct
aatcaggcactggggcagtgtttgggcgggcaggggattaaccaattgatgagccaatta
caaaaccgtttagtgggtcatggttatgtcacgacccgggtgcttgctccacagcaggat
ttgaacagcggcacactggcgttacaagtggtgcccggcaaaatacaccgcgtggcgctg
acaccagagagtgaccgccatgtcacgctgttcagtgcctttcccgcacgccccggtcac
ttattggatctgcgtgatattgagcaagggctggagaatcttcaacgtatccccacagtg
caagccagcatggaattgatccccggcagcgcgcccggagagaccgatatcgccctaagc
tggaagcagagcaaaatgtggcgtttggccgcctcactggatgactcagggactcgcagt
actggccgttatcagggcggtgcgacgctgtttctggataacccattctctttgagtgac
cagttttatgtctcggcgggtggctcaataaaaaatcgcggcgataaaggcaccaataac
ctgactggccactactcgttgccgttcggttactggacagccggcataaccgccagcagt
tatgattatcaccagacagtggcgggcctgaatagcgattacaactatcggggcgaaagt
gaaaatgtgtcattgcaactcagccgcctgttgcaccgcaatgccagccaaaaaaccaca
ctcacctacgatgtcctgacccgttcgtcgaaaaactacatcaatgataccgaagttgag
gttcaacgccgccgcacatctgcctggcgcatagggctgcaacatcgccactttatttcg
caggccacgctggatgccggggtgagttatcagcgcggtacccgttggtttggggcggtt
ccggctcaagaagaatattttgatgaaggcacggcgttaagcaagattctgcaattgaat
gcacaactggatattcccttctcggtgatggcgcaaaatttccattacaacgtgcaatac
cagcgtcagagcagcagcaccccgttgaccccacaggatcaattcagcattggtggccgt
tggtcagtgcgcggctttaatggggagcggaccctcagtgctgatcgtggctggacggtg
cgtaatgatctgggttggtacacaccgatacaggggcaagagatctatgtcggccttgat
tatggcgaagtgggtggccgcggaagcgcttatctgctgggtaaccatctggcgggtgcc
gctgtcggtattcgtggcaacgtactcaatacccgctatgacctgtttgccggcaaaccc
ctgtctgaacccgatggcttccaatccgatgccgtgaccgtgggctttaacctgaactgg
caatactaa

DBGET integrated database retrieval system