KEGG   Yersinia pestis D182038: YPD8_2214Help
Entry
YPD8_2214         CDS       T01833                                 

Definition
(GenBank) hemagglutinin-like secreted protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2821119..2822690
Genome map
AA seq 523 aa AA seqDB search
MGRDLLLQSQQDSDNYDAKQQSSSVGGSFSPGSMTGSISINGSQDKLNSNFDSVQEQTGI
FAGSGGFDITVGGHTQLDGAVIGSTVTADKNTLDTGTLGFSDIDNQADFKVEHQSVGIST
GGNIGSQFVGNMANGLLVGANNEGHADSTTHAAVSEGTITVRDTDNQQQNVDDLSRDVEQ
ANNALSPIFDKEKEQNRLKEAQLIGEIGSQVGDVFRTQGQIIATQAANEKMQGVSEADRE
AAKANWEKANPGQVATAEDINGQVYKTAYDQAFNASGYGTGGKFQQTVQAATAALQGLAG
GDIAKAIAGGSAPYLAEVIKQSTGDNEEARLAAHAVVGSVLAHLQGNSAVAGGAGALTGE
IAADLIMQQLYPGKMVSELSETEKQTISALSTLAAGLAGGLTGDSSADAVAGAQAGKNAV
ENNALGLALKGCGIAAPCRSLIAKQVLEIGVKAGITGIVAKEIADKISEDDLDHLVTLKM
MGNDEITEKYLNSLQDKYAPAHTGGDQNAGSGPTDTGGQSNSG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgggccgcgacctgttgctgcaaagccagcaggacagcgataactatgatgcgaagcag
caaagtagcagtgttggcggcagtttcagccctggctccatgacgggcagtatcagtatc
aatggcagccaggacaagctgaacagcaactttgactcggtgcaggagcagacgggtatc
tttgccggttcgggcggctttgatatcacggtaggtggacacactcagcttgacggtgcg
gtgattggcagcaccgtgacagccgataaaaacacgctggataccgggacactgggcttc
agtgatatcgataatcaagccgatttcaaggttgaacatcaaagtgtgggtatcagcacc
ggggggaatatcggcagtcagtttgttggcaatatggccaacggcttgctggtcggggcc
aataacgaaggtcacgccgacagcaccacccatgcggccgtttctgaaggtacgatcacg
gtgcgcgacacggataaccagcagcagaatgttgatgacctgagccgtgatgtggagcag
gccaacaatgccctttcccctatctttgataaagagaaagaacaaaaccggctgaaggaa
gcgcagcttatcggcgagataggcagtcaggtgggtgatgtgttccgcacgcaagggcag
attatcgccacccaggcggcgaatgaaaaaatgcagggggtgagtgaggctgatcgtgag
gcggcgaaagccaactgggaaaaagccaatccgggtcaggttgcaacggctgaggatatc
aacggtcaggtttataaaacggcctatgatcaggcattcaatgcgtcgggttacggcacc
gggggtaaattccagcagacggtacaagcggcgacagcggccctccaggggctggcgggc
ggagatatagccaaagcgatagcgggaggcagtgcgccgtatctggcggaagtgattaag
caaagcacgggtgataacgaagaagcgcgactggcggcacatgcggtggtcggttctgtt
ctggcacatctacagggcaatagtgcggttgcgggaggcgcaggtgccttgacgggtgag
atagcggctgatttaatcatgcagcagttgtacccggggaaaatggttagcgaactcagc
gagacagaaaaacagaccatcagcgcgttaagtacattagcggcagggctggcggggggc
ttgacgggagacagcagcgccgacgcggttgcgggtgcgcaggctgggaaaaatgcggtg
gagaataatgcgctgggtctggctctgaagggatgtggtatcgctgcaccctgccgaagt
ctgatagcgaagcaagttttggagatcggtgttaaagcgggtattacgggtattgtcgcc
aaagagatcgcagacaagatatcggaagacgatcttgatcatcttgttactctgaagatg
atgggcaatgatgagatcaccgaaaaatacctgaattcgcttcaggataaatatgcacct
gctcataccggtggtgatcagaacgctgggtcgggtccaaccgatacgggggggcaatca
aatagcggataa

DBGET integrated database retrieval system