KEGG   Yersinia pestis D182038: YPD8_2220Help
Entry
YPD8_2220         CDS       T01833                                 

Definition
(GenBank) putative solute-binding protein
  KO
K02027  
multiple sugar transport system substrate-binding protein
Organism
ypx  Yersinia pestis D182038
Module
Putative multiple sugar transport system
Brite
Transporters [BR:ypx02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    YPD8_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2829792..2831078
Genome map
AA seq 428 aa AA seqDB search
MLEKMKNTLISLAIASSCVVFTGCDNDTASAKNEKQDITLWIAPNNVQEAFWSEVVGEWN
KQPDKKKVVFSTIPAAGSSEEAIMNAIASDRAPDISENIFTGFGSQLADLGQVVDLSTLD
GYENLISTRQMTDIMDNWRYNGKNYILPIYMNPVLFWWRGDLLKEQGFSEVPKTYDEVYA
LSEKYTIPDKRYAIQATSGRNWWDRWFDFIALYYAQSDGKPYIANQQASYDNQAGRDVLD
FMHTLFSKKWTLYDFGQDDPLVTGKVLGAVRGPWDISRYQQQYPEILKHIKMGPMLVKEQ
QDKPHTFADGKGLVLFSHSKVKPEAWEFIQWVFSQPKFDKRWMELTGMPPARADLLTNPF
FAEYYQEHPYAAAYAEYVNVAIPPVSSGETVEIQRSMTQMIEKTAFNTATPDEALQQSIK
EVNAILKP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaaatgaagaataccctgatttcattggcaattgcctccagttgtgtggtg
tttactggctgtgacaatgatacggcatcggctaaaaatgaaaaacaggacatcacgctt
tggatagcgccgaacaatgtccaagaggcattctggagcgaagtggttggggagtggaat
aaacaaccagataaaaagaaagtcgtcttctcaacgatcccggcagcgggcagctctgaa
gaggcgataatgaatgcgattgcttctgatcgcgcacctgatatctcagaaaatattttt
accggctttggttctcagcttgctgacttagggcaggtcgttgatctctcgacgctggat
ggctatgaaaacttaattagtacccgtcagatgacggatattatggataattggcgctat
aacggaaaaaactacatcctgccgatttatatgaacccggtactcttttggtggcgtggc
gatttattaaaagagcagggctttagcgaggtgccaaaaacgtatgacgaggtttacgca
ctctccgaaaaatacaccattccagacaaacgttatgcgatacaagctacttctggccgt
aactggtgggaccgttggtttgattttattgccctctattatgcccaaagtgatggcaag
ccttatatcgccaatcagcaagccagctatgataaccaggccggtcgtgacgttctggac
tttatgcacacactcttttcaaaaaaatggaccctttatgattttggccaggatgatcca
ttagtcaccggtaaagtattgggcgcagtacgcggtccttgggatattagccgctaccaa
caacaatatccggaaattttaaagcacataaaaatggggccgatgctggttaaagagcag
caagataaaccacatactttcgccgatggtaaaggactggtgctgtttagtcattcaaag
gttaaacccgaggcgtgggagtttatccagtgggtattcagccagcccaaattcgataaa
cgttggatggaattgaccggtatgccacccgctagggcagatttgctcaccaatcctttc
tttgccgaatattatcaggaacacccgtatgccgcggcctacgctgaatatgtcaacgtg
gcgatacctccggtttccagtggtgaaacggtggaaattcaacgcagcatgacacaaatg
attgagaagaccgcgtttaatactgcaacgcctgatgaagcattgcaacagtcaataaaa
gaagtgaacgcgattttaaagccctaa

DBGET integrated database retrieval system