KEGG   Yersinia pestis D182038: YPD8_2221Help
Entry
YPD8_2221         CDS       T01833                                 

Definition
(GenBank) sugar ABC transporter, permease protein
  KO
K02025  multiple sugar transport system permease protein
Organism
ypx  Yersinia pestis D182038
Module
ypx_M00207  Putative multiple sugar transport system
Brite
Transporters [BR:ypx02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    YPD8_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF2157
Motif
Other DBs
NCBI-ProteinID: ACY62896
Position
2831187..2832062
Genome map
AA seq 291 aa AA seqDB search
MTFLKLKDKQVGSVLAASYLGYTSIFWFYPFIWLAVLSLTEWRFVGIPTFNGLNNFILVM
QDPLFWKSMLNVMRFLMYYLPIVFISSFLFAFGLQKLKHGRTFVALSFLLANVSSGVAYS
IVFSKIFSQNGPLNTFLYDWFGFTLPWLTSPDFAMLSIALVVTWKFVGYYGLILFSGLNS
IPKEIYSAAELDNTRTIKRLFHITLPMINPQLIMVLVLAITVSFAIFTEPYLITGGGPLN
STTTPMIVMYETAFMKMQPSWAATMSIFIALISFGIILGVRKLLERKVEIV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacttttttaaagcttaaagataaacaggtaggcagcgtattagcggcctcttatctg
ggatataccagcatattctggttttatccttttatttggctcgccgttttatcgctaact
gagtggcgttttgttggtattcctacgttcaatggtctgaataactttattctggtaatg
caagatcctttgttttggaaatcgatgctgaacgtgatgcgtttcttaatgtattacttg
cccattgtatttatctcttcattcctgttcgcgtttggtttacagaaattaaaacatggc
aggacctttgttgcattaagttttttactggctaacgtctcatctggcgtggcctattcc
atcgtgttctctaagatatttagtcagaatgggccgctgaataccttcttatatgattgg
tttggatttacgctgccttggttaaccagcccggacttcgccatgttatctatcgctttg
gtcgttacctggaaatttgtcgggtactacgggttgattctcttttctgggttaaacagt
attcccaaagaaatttattcagcagcggaattagataatactcgcaccattaagcgcttg
ttccatatcacattaccgatgatcaacccgcaattaattatggtgctggttttagccatt
acggtctccttcgctatttttaccgagccatatctcattactggtggcgggccgcttaat
agcaccaccacgccaatgatcgtgatgtatgaaaccgcgtttatgaagatgcaaccaagt
tgggcagcgaccatgtcaatctttatcgcgctcatcagttttggaattatcttgggtgtc
agaaaattgctggaaagaaaggtagagattgtttaa

DBGET integrated database retrieval system