KEGG   Yersinia pestis D182038: YPD8_2221Help
Entry
YPD8_2221         CDS       T01833                                 

Definition
(GenBank) sugar ABC transporter, permease protein
  KO
K02025  
multiple sugar transport system permease protein
Organism
ypx  Yersinia pestis D182038
Module
Putative multiple sugar transport system
Brite
Transporters [BR:ypx02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    YPD8_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2831187..2832062
Genome map
AA seq 291 aa AA seqDB search
MTFLKLKDKQVGSVLAASYLGYTSIFWFYPFIWLAVLSLTEWRFVGIPTFNGLNNFILVM
QDPLFWKSMLNVMRFLMYYLPIVFISSFLFAFGLQKLKHGRTFVALSFLLANVSSGVAYS
IVFSKIFSQNGPLNTFLYDWFGFTLPWLTSPDFAMLSIALVVTWKFVGYYGLILFSGLNS
IPKEIYSAAELDNTRTIKRLFHITLPMINPQLIMVLVLAITVSFAIFTEPYLITGGGPLN
STTTPMIVMYETAFMKMQPSWAATMSIFIALISFGIILGVRKLLERKVEIV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacttttttaaagcttaaagataaacaggtaggcagcgtattagcggcctcttatctg
ggatataccagcatattctggttttatccttttatttggctcgccgttttatcgctaact
gagtggcgttttgttggtattcctacgttcaatggtctgaataactttattctggtaatg
caagatcctttgttttggaaatcgatgctgaacgtgatgcgtttcttaatgtattacttg
cccattgtatttatctcttcattcctgttcgcgtttggtttacagaaattaaaacatggc
aggacctttgttgcattaagttttttactggctaacgtctcatctggcgtggcctattcc
atcgtgttctctaagatatttagtcagaatgggccgctgaataccttcttatatgattgg
tttggatttacgctgccttggttaaccagcccggacttcgccatgttatctatcgctttg
gtcgttacctggaaatttgtcgggtactacgggttgattctcttttctgggttaaacagt
attcccaaagaaatttattcagcagcggaattagataatactcgcaccattaagcgcttg
ttccatatcacattaccgatgatcaacccgcaattaattatggtgctggttttagccatt
acggtctccttcgctatttttaccgagccatatctcattactggtggcgggccgcttaat
agcaccaccacgccaatgatcgtgatgtatgaaaccgcgtttatgaagatgcaaccaagt
tgggcagcgaccatgtcaatctttatcgcgctcatcagttttggaattatcttgggtgtc
agaaaattgctggaaagaaaggtagagattgtttaa

DBGET integrated database retrieval system