KEGG   Yersinia pestis D182038: YPD8_2223Help
Entry
YPD8_2223         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K20885  
beta-1,2-mannobiose phosphorylase / 1,2-beta-oligomannan phosphorylase [EC:2.4.1.339 2.4.1.340]
Organism
ypx  Yersinia pestis D182038
Brite
Enzymes [BR:ypx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.339  beta-1,2-mannobiose phosphorylase
     YPD8_2223
    2.4.1.340  1,2-beta-oligomannan phosphorylase
     YPD8_2223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2833034..2834089
Genome map
AA seq 351 aa AA seqDB search
MMRYSGNPLITPQDITPSHPGFKVECAFNAGITKLGDETIMLIRIAESVIPESEGITVVP
LLMEISGHWQVTTRVFKHDDPAYDFSDPRLISDIADPSTVYLTSLSHLRVARSHDGVTFV
VDDQPFIFPANGDEAFGCEDARITQIDGAYYINYSAVSAKGICTALAVTQDFTDVKRLGL
IFCPDNRDACLFPEKINGKYMTLHRPAPKHFGKPEIWLASSLDLLHWGDHRHLLGTSQDP
WDALKLGGGAQMLKTEKGWLQIYHGVDATQRYSLGALLLDLEQPTKILAKSPVPLLQPQA
PYELHGFFGNVVFTCGALIENDSLRVYYGAADECMCLAEMPLAQLWQHLSV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtattccggcaatccgttaatcacaccccaggatattacgccaagccatccg
ggatttaaggttgaatgcgcctttaatgcgggcattaccaaactgggcgatgagacgatt
atgttgattcgtatcgcggagagcgttatccctgaaagtgagggtattaccgtcgtgcct
ttgcttatggaaatttccgggcactggcaggtgaccacgcgggtatttaagcacgatgac
cccgcctacgattttagtgatcctcggctgatcagtgatattgccgatccatcgaccgtg
tacctgacatctctctcccatcttcgtgtggcaagaagccatgatggcgttactttcgtc
gttgacgatcaaccctttatcttcccggccaacggtgatgaagcttttggttgtgaggat
gctcgcattactcagatcgacggcgcttactatattaactattccgcagtgtcagcaaag
ggcatttgcaccgcgctggcggttacccaggatttcaccgacgttaagcgtttggggctg
attttctgccctgataatcgcgatgcgtgtctgttcccggaaaaaatcaacggtaaatat
atgacgttgcaccgcccggcacctaaacacttcggtaaacccgagatttggctggccagc
tctctggatctgctgcattggggagatcatcggcatttactggggacatcgcaagaccct
tgggatgccttgaaactggggggcggggcgcaaatgctgaaaacagaaaaagggtggctg
caaatttaccatggggtagatgcgacccaacgctattctctcggtgcgctgctgctagac
ctggaacagcctactaaaatccttgctaaatcgccggtaccgttgcttcaaccgcaggct
ccttatgagctgcacggcttttttggtaacgtcgtctttacctgcggcgcactcattgag
aacgatagcctacgggtctattacggtgcggcggatgaatgtatgtgcctggctgaaatg
ccgctggctcaactgtggcagcacctgtcggtgtaa

DBGET integrated database retrieval system