KEGG   Yersinia pestis D182038: YPD8_2226Help
Entry
YPD8_2226         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
2836331..2837605
Genome map
AA seq 424 aa AA seqDB search
MKLLNTLVCIIGLTSFSSSAKLVNAEHLDALYQKVTVANKTELGLIHIYSEFPDYRWVKD
PIEGVSAIDDVARAAIFYQRQYQATGSAADLEKVKSLVEFILYQRADNGYFYNFIYPDHS
INKEYKTSVAEPNWWTWRALWALTQVYPTLVKTDNALAQRTRETIFATIDVIYKDFNFKQ
TRGEKEGVAVPEWLPHTAGDQASVLLMALSDAQALEAKPEIEKMMRSLAAGIMLMQVKDT
SSPVNGAFLSWQNLWHGYGNSQAYALLVAGNRLGDRDMIKAAFNELDHFHPWLISNGLLN
EFTVRQQGEKVTLIEQKKFSQIAYIIRPMVFANIKAWEISRDAVYLERAVDLSLWFFKNN
PAQAQMYYPVTGIAFDGIDSATTVNKNSGAESTIEALLTLQLIESIPDAKRMLESALEKR
NIKQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaactactaaataccctggtttgtatcattggtttaacatcattttcttcctctgcg
aagctggttaatgctgagcatctggatgccttatatcaaaaggtcacggtggcgaacaaa
acagaactgggtctgattcatatctatagcgaatttccagattaccgctgggttaaagat
cccatcgaaggtgtatccgccattgatgatgtcgcccgcgcggcaattttttatcaacgt
caataccaggcaacaggctcagcggcagatttagaaaaagtaaaatcgctggtcgaattt
attctgtatcaacgggcagataatggttacttctataattttatctaccctgatcattcc
attaataaagagtataaaaccagtgtggcggagccaaattggtggacatggcgtgcatta
tgggcgctgactcaggtttatcctacgctggtgaaaaccgataacgcgttggcgcaaaga
acccgcgagactattttcgccaccatcgatgttatttataaagactttaatttcaaacag
actcgtggcgaaaaagagggcgtggcggtgccagagtggctgccccataccgctggtgac
caagcctctgtattgttgatggccctgagcgatgcacaagcgctggaagcaaaaccagaa
attgaaaagatgatgcgttcactggcggctggcatcatgctgatgcaggttaaggataca
tcttcaccggtgaatggcgcctttttaagctggcaaaacctgtggcatggctatggtaac
agccaggcttatgctttgttggttgcgggtaaccggctgggcgatagggatatgattaaa
gctgcctttaacgagctggatcatttccatccttggttgatcagtaatgggttgttaaat
gagtttaccgttcggcagcagggtgaaaaagtcacgctgattgaacagaagaagttttcc
cagattgcttacatcatccgcccgatggtatttgccaatatcaaagcttgggagatttcg
cgtgacgccgtttatctggagcgcgcggtggatttatcgctgtggttctttaaaaataat
ccggcacaggcacaaatgtattaccccgtaaccgggatcgcatttgatggtattgattcg
gccactaccgtgaataaaaactcgggagcagaatccacgattgaagcgttgctcactctt
cagttgattgaatctatccctgatgccaagcgcatgttggaatcggcacttgaaaagcgg
aatatcaaacagtga

DBGET integrated database retrieval system