KEGG   Yersinia pestis D182038: YPD8_2229Help
Entry
YPD8_2229         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K07012  
CRISPR-associated endonuclease/helicase Cas3 [EC:3.1.-.- 3.6.4.-]
Organism
ypx  Yersinia pestis D182038
Brite
Enzymes [BR:ypx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     YPD8_2229
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     YPD8_2229
Prokaryotic defense system [BR:ypx02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Type I signiture cas proteins
    YPD8_2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2841560..2844343
Genome map
AA seq 927 aa AA seqDB search
MNILLISQCHKRALNETRRILDQFAERKGDRTWQTAITQEGLNTLRKLLRRTARRNSAVA
CHWIKSNNQSELLWIVGNLRRFNAEGTVPTNTTQRDILRSQDENNWHSVETIALLAGIAG
LFHDFGKANVLFQQGLQGQGKTYQPYRHEWVSLRLFQAFVEQKNDIQWLTALSQINPADE
TTLMSNLVKDGLDDYTNPLAALPPLAKTIAWLILSHHRLPVYPSKDYHRPPKVEEIDDWL
HQQLMPVWNSTNMDSGDWREKDKLDVWRFPHGTPLQSAEWCKKAQKFAKRALRQPSLVND
GHLNQRFTSHMARLVLMLADHHYSSLPATPGWQDKNYQVFANTHNKMRDANAHSKTIEMK
QRLDEHNIGVGQNALLLGRSLPHIRKTLPAITRHKGFKQRSVQEKYRWQDKAFDLAVTLR
ERSLQQGFFGVNMASTGCGKTFANARIMYGLSDEKQGCRFSVALGLRTLTLQTGTALQQK
LTLQKDDLAVLIGSQSVLQLYQLNNDKLEPRGTGSQSADKFFSEHQYVSYDGSLDDGRLS
TWLSNNDRLKRLLCAPVLVCTIDHLIPATESLRGGKQIAPMLRLLTSDLVLDEPDDFDRN
DLPALCRLVNWAGMLGSRVLLSSATLPPALVQALFNAYRAGRADYQQASGQPDTPVNICC
AWFDEHGVAQQDIQQSKDFIQHHGDFITRRVGKLSTAEVLRRAELIPVSSASVKNGSVLD
AMAAVMRDSMLRLHQAHHQTHPSEKTVSVGVVRMANIDPLVAIAQRLYAMAAPVNYRIHY
CVYHSQHPLAVRSAIERRLDVTLTRYQPNALWQVAEIEHALQHHPEQHHLFVVLATSVVE
VGRDHDYDWALAEPSSMRSFIQLAGRVQRHRQVAPQMANMHILQKNFKALTQKDPAIPVY
CKPGFETTRCRRTPMIWISCSYPHNIK
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttactgatatcccaatgccataaacgggcgcttaatgaaacacgccgtatt
ttggatcagtttgctgaacgtaaaggtgatcggacatggcagacggcaataacgcaggaa
gggctaaatacattacgtaaattattgcgtagaacggcgcggcgtaatagtgcggtggcc
tgccattggatcaaaagtaataaccaaagcgagttgctatggattgttgggaatttaagg
cgtttcaatgctgagggaaccgtgccaaccaatactacgcaacgggatatcttgcgcagc
caggatgaaaataactggcacagcgtggagaccattgcactgctggccggtatcgctggg
ttatttcatgattttggtaaggccaatgtactatttcaacaagggttgcaagggcagggg
aaaacatatcaaccctatcggcatgagtgggtttcattacgtttatttcaagcttttgtt
gaacagaaaaatgatattcaatggctcacagccttaagccaaattaatcccgctgacgaa
accactttaatgtccaatttggttaaagatgggctagacgactataccaatcccctcgct
gcattacctcctcttgccaagactatcgcgtggttgatcctttcacaccatcgcttaccc
gtgtatccctccaaggattaccatagaccacctaaagtagaggaaatcgatgattggttg
caccagcagcttatgccggtatggaattcgaccaatatggacagcggtgactggcgtgaa
aaagataagctggatgtatggcgcttcccgcatggcacgccactacaaagtgccgaatgg
tgtaaaaaggcacaaaagtttgccaaacgcgctttgcgacaaccgtcattggttaatgat
ggtcacttgaaccagcgttttaccagccatatggcgcgtctggtgttaatgctggccgat
catcattattcttcattaccggccactcccggttggcaggataaaaactatcaagtattt
gcaaatacccacaataaaatgagggatgcgaatgcccacagtaaaacgattgaaatgaag
cagcggctggatgaacataatattggtgtggggcagaacgcgctgttgcttggccgcagc
ttgccacatatccgcaaaaccttaccagcaatcactcgccataaaggatttaaacaacgt
tcggttcaggaaaagtatcgttggcaagataaagcctttgatctggctgtcacgctgcgc
gagcgttctctgcagcaaggttttttcggcgtcaatatggcctcaaccgggtgcggtaaa
acctttgcaaatgcccggataatgtatggtttgtccgatgaaaaacagggatgccgcttt
tctgttgctttgggcctacgcaccttaaccttgcagaccggtaccgcattgcagcagaag
ttaaccttacaaaaggacgatttggccgtcttgattggttctcaatcggtcttgcaatta
tatcaattaaataacgataaattggaacctcgtggaaccggcagtcagtcggcggataag
tttttttctgagcatcagtatgtcagttatgacggcagtttggatgatgggcggctgagc
acttggttaagtaataacgatagattaaagcgtttgctctgtgcgccagtactggtctgc
accattgaccacctgatccctgccaccgagagcctacggggtggcaagcagatagcccca
atgctgcgtttgctaacctccgatttagtattggatgaaccggatgattttgatcgcaat
gacttgcccgcgctatgccgcttggtgaattgggcgggcatgttaggttcccgcgttctg
ctttcgtcagccacattgccgccagcattagtacaagcgttgttcaatgcttatcgtgcg
gggcgggctgattatcaacaagccagcgggcaaccggatacgccggttaatatttgctgt
gcctggtttgatgaacatggcgttgcacagcaagatatccagcagtcaaaagattttatc
caacatcatggcgattttatcactcgccgagtggggaaactgtctacggcagaggtgctg
cgcagagccgagttaattccggtcagctctgccagtgtgaagaatggctcggtgctagat
gctatggcggcggtgatgcgcgattctatgctgcgcttacatcaggcacatcatcaaact
cacccttctgagaaaaccgtttcagtgggtgtggtcaggatggccaatattgatccgctg
gtggcgattgcccagcgcttatacgcgatggccgcgccagtaaattaccgtattcattac
tgtgtctatcatagtcagcatccgctagcggtgcgttctgctattgaacggcggttggat
gtgacgttaactcgctatcagcctaatgcactttggcaggtagccgaaattgaacatgca
ctacagcaccatccggagcagcatcacctgtttgtggtgctcgccacctcggtggttgaa
gtgggcagggaccatgactacgattgggcgctagccgaacccagctctatgcgctcgttt
atccagttggcagggcgtgtacaacggcaccggcaagtcgcgccgcagatggcgaatatg
catattctgcaaaagaattttaaggcactgactcaaaaagatccggcgatccccgtttat
tgcaaacccggttttgagaccacccgttgtcggcgaacacccatgatctggataagctgc
tcttaccctcacaatataaagtga

DBGET integrated database retrieval system