KEGG   Yersinia pestis D182038: YPD8_2230Help
Entry
YPD8_2230         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
2844340..2844846
Genome map
AA seq 168 aa AA seqDB search
MINAISRIQERTKLEPRDNFVDLEHLSLRLILQGSAEPLKYYAALWWRKQATWSGEQQRC
TPFRQSSPDEQHNLWIDDEADKPVFKRLDSDQIEWKVSDGFQDVELTLAAGNSAWIDTDC
LRIYQWLAESLNKELNEVSRQFGEVRLPKKDGERWHYHPLLGVFGALD
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgattaatgccatcagccgtattcaagaaagaaccaaactcgaacctcgagataatttt
gttgatttagaacatcttagcttgaggttgatattgcagggtagcgctgaaccgttgaag
tattatgccgcattatggtggcgtaaacaggcgacctggagtggggagcagcaacggtgc
acccctttccgacaatccagccctgatgaacagcataatctgtggattgacgatgaagcg
gataaaccggtgtttaaacgtcttgatagcgaccagattgagtggaaagtcagtgatggg
tttcaggacgttgaactgacactggcagcaggaaacagtgcatggatagacaccgattgt
ctgcggatttatcagtggctggcagagtcattaaataaggaattaaacgaggttagccgg
caatttggtgaggtccgcctgcccaaaaaagatggcgagaggtggcattatcatccgcta
ttaggggtgtttggcgcactcgattga

DBGET integrated database retrieval system